(data stored in ACNUC1104 zone)

EMBL: FN667742.FTSE

FN667742.FTSE        Location/Qualifiers
FT   CDS_pept        576111..576776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0123"
FT                   /gene="ftsE"
FT                   /locus_tag="XNC1_0663"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88734"
FT                   /db_xref="GOA:D3VJH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88734.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLLPGEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGNIWFAGHDVSRLTSREIPFLRRQIGMIFQDHHLLLDRTVYENIAMPL
FT                   IISGASAEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPTVLLADE
FT                   PTGNLDGELSEGIMRLFEAFNRVGVTVLMATHDIALIERRNNRILTLNQGRMQGGQHG"
     atgattcgct ttgaacaggt cagtaaagcc tatctgggag ggcggcaagc gctgcaaggg        60
     gtggattttc atctgcttcc cggtgaaatg gcatttttaa ccggtcattc aggggctggt       120
     aaaagtacac ttttaaaact tatctgtggt atcgaacgtc ccagcgctgg caacatctgg       180
     tttgcgggtc atgacgtcag tcggttaacg tctcgtgaga tccctttcct gcgtcgtcag       240
     atcggtatga tttttcagga tcatcacctg ctgctggatc gtacagtata cgagaatatt       300
     gccatgcctc tgatcatatc aggggcaagt gctgaggata ttcgtcggcg ggtatctgcg       360
     gcactggata aagtcggctt actggacaaa gcgaaaaatt ttcccatcca gctttctggt       420
     ggtgagcagc agcgtgttgg cattgcccgc gctgtcgtga acaaacccac tgttttgctg       480
     gcggatgaac cgacaggaaa tctggatggt gaattatctg aggggattat gcgtctgttt       540
     gaggcattta accgcgttgg tgtgacggtt ttgatggcaa cgcatgatat tgccctgatt       600
     gagcgaagaa acaaccgtat cctgactctg aatcaggggc gtatgcaagg agggcaacat       660
     ggttaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page