(data stored in ACNUC1104 zone)

EMBL: FN667742.FTSX

FN667742.FTSX        Location/Qualifiers
FT   CDS_pept        576769..577743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0123"
FT                   /gene="ftsX"
FT                   /locus_tag="XNC1_0664"
FT                   /product="integral membrane cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88735"
FT                   /db_xref="GOA:D3VJH9"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88735.1"
FT                   /translation="MVKPVRHSAKKTLPPKSKSLKGGWRVQRRYAWKSTLSDMLRQPLA
FT                   TLLTIMVIAISLTLPSVFYIVWKNVNQAVVQWYPIPQLTVYLDKSLNDNSAKGVIDQLK
FT                   SMEGVQSVNYLSREEAVNEFRAWSGFASALNLLEENPLPAVAIVSPKLNFQDSQAITAL
FT                   RDQVAQIKGIEEVRMDDSWFARLTALTSLIGRIAAVIGILMVVALLLVIGNSVRLSIFS
FT                   RRETINVMKLIGATDGFILRPFLNGGALLGILGAVFSLILSSLLVWKLSNVVMEVAGVF
FT                   GTSFKLHGLGWDESLLLVLIAGMIGWIAAWFATIQHLRRFRPE"
     atggttaagc ctgtccgtca ttcagcaaaa aaaacattgc cccccaagtc caagtcgttg        60
     aaaggcggat ggcgtgtaca gcggcgctat gcgtggaaaa gtaccctgtc agatatgttg       120
     cgccagccgt tagccacatt attgaccatc atggtgattg cgatttcatt gaccctgcca       180
     agcgtgtttt atatcgtttg gaaaaatgtt aaccaggcgg tggtacagtg gtatcccatt       240
     ccgcaactca cggtctattt ggataaatca ctgaatgaca atagtgccaa aggagtcatt       300
     gatcagctga aaagcatgga aggtgtgcaa tcagtgaatt acctttcccg tgaagaagcg       360
     gtaaatgaat ttcgggcgtg gtctgggttc gccagtgcgt tgaatctgtt ggaagaaaat       420
     cctttgccgg cagttgccat tgtctctccc aagttaaatt ttcaagattc acaagcaata       480
     acagctttgc gtgatcaggt ggcccagatt aaaggcattg aagaggtcag aatggatgac       540
     agttggtttg cccggctgac tgcgctgact tcgcttattg gccgaatcgc tgccgtcata       600
     ggtatcttga tggtggtggc attgcttttg gtgattggta atagtgttcg tctgagtatc       660
     tttagtcgcc gtgaaaccat taatgtgatg aaactgattg gggcaacgga tggctttatt       720
     ctgcgtcctt tcctcaatgg tggagctttg ttggggattt tgggcgctgt tttttccctg       780
     atcctttcgt ccttattagt gtggaaactc tctaatgtcg tcatggaagt ggcaggggta       840
     ttcggaacga gttttaaact gcatggattg ggatgggatg aatcactgtt gctggtactt       900
     attgcaggta tgataggttg gattgcagcg tggtttgcca caattcagca tttacgtcgt       960
     tttaggccgg aatag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page