(data stored in ACNUC1104 zone)

EMBL: FN667742.GIDB

FN667742.GIDB        Location/Qualifiers
FT   CDS_pept        complement(35772..36392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0005"
FT                   /gene="gidB"
FT                   /locus_tag="XNC1_0033"
FT                   /product="glucose-inhibited division protein, contains
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88126"
FT                   /db_xref="GOA:D3VG36"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88126.1"
FT                   /translation="MLNKLESLLAKTDIALSQEQKQQLVAYVEMLNKWNKAYNLTSVRD
FT                   PEQMLVRHIMDSIVVNPFLHGTRFIDVGTGPGLPGVPLAIVRQDSHFTLLDSLGKRVRF
FT                   LRQVQHELGLTNIDPVQSRVEEFIPEPPFDGVISRAFASLQDMLSWCRHLPKPLEGRFY
FT                   ALKGGLPEDELANLPTGFILDTVIPLQVTELDEQRHLVILKSN"
     ttgcttaaca aattagaatc gctgctggcg aagactgaca ttgcgttatc acaggaacaa        60
     aaacagcagc ttgttgccta cgttgaaatg ctcaacaaat ggaataaggc ttataacctg       120
     acatctgtcc gggatccgga acagatgttg gttcgccata tcatggacag catcgttgtt       180
     aacccatttc ttcacggaac gcgatttatt gatgtaggga ctgggcctgg tttgccgggg       240
     gttccactgg ccattgtgcg tcaagactcc catttcactt tgctggatag tctgggaaag       300
     cgggttcgat ttttacgtca ggttcagcat gaacttggtt taaccaatat tgatccagtg       360
     caaagccgcg ttgaggaatt tattcctgaa cctccttttg atggtgtgat tagtcgggca       420
     tttgcttctt tgcaagatat gctttcatgg tgccgtcacc tccctaaacc acttgaaggg       480
     cgtttttatg ctttaaaagg cggattaccg gaagatgagt tagcgaattt gccgacagga       540
     ttcatccttg ataccgttat ccctctccaa gttacagagc tggatgaaca gcgccattta       600
     gttatcctga agtcaaacta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page