(data stored in ACNUC1104 zone)

EMBL: FN667742.GLPK

FN667742.GLPK        Location/Qualifiers
FT   CDS_pept        complement(187415..188938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0043"
FT                   /gene="glpK"
FT                   /locus_tag="XNC1_0213"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88301"
FT                   /db_xref="GOA:D3VH16"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88301.1"
FT                   /translation="MTIENITEKKYIVALDQGTTSSRAVVLDHDANIVCISQREFPQIY
FT                   PKPGWVEHDPMEIWASQSSTLVEVLAKADISSDQIAGIGITNQRETTIVWEKETGKPVY
FT                   NAIVWQCRRTADICTKLKQKEGLEEYIHHNTGLVIDPYFSGTKIKWILDNVAGVRERAE
FT                   KGELLFGTVDTWLVWKMTQGRVHVTDSTNASRTMLFNIHNLDWDQKILNELGIPRIILP
FT                   KVAASSEIYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVHPGMAKNTYGTGCFLLMN
FT                   TGKDAVRSNHGLLTTIACGPRGEINYALEGAVFVGGASIQWLRDELKLIADAADSEYFA
FT                   SKVKDSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGTNSNHIIRATLESIAYQTRDVL
FT                   DAMQADAGTRLQALRVDGGAVANNFLMQFQADILGTRVERPEVRESTALGAAFLAGLAV
FT                   GFWQDLDEVKSKATIEKEFRPGIETTERNHKYNGWKKAVARAQEWEDRA"
     atgacaatag aaaatatcac cgaaaaaaaa tatatcgtcg ctctggatca gggcacgacc        60
     agctcacggg ccgttgtact tgatcacgat gccaatattg tctgcatttc acaacgagag       120
     ttcccgcaaa tctacccgaa acccggctgg gtagagcacg atccgatgga aatctgggca       180
     agccaaagct ctacattggt tgaagtactg gccaaagcag atatcagctc tgatcaaatt       240
     gccggcattg gtattactaa ccaacgggaa accaccattg tctgggaaaa agagacaggt       300
     aaacctgttt ataatgcgat tgtatggcag tgccgccgaa cggccgacat ctgtaccaaa       360
     ctgaaacaaa aagagggtct ggaagagtac atccaccaca ataccggttt ggttattgac       420
     ccctatttct cgggcacgaa aataaaatgg attttggaca atgttgccgg tgtccgtgaa       480
     cgtgctgaaa aaggtgaatt attgtttggt acagtcgata cctggttggt ctggaaaatg       540
     actcagggac gtgtacatgt gactgattcc accaacgctt cccgtacgat gctattcaat       600
     atccacaacc tggactggga tcagaaaatc ctcaatgaac tggggatacc tcgtattatt       660
     ctgccaaaag ttgcggcttc ttcagaaatt tatggtcaga ccaatattgg tggtaaaggg       720
     ggtacacgta ttcctatcgc cgggattgcg ggtgaccagc aagccgcgct gtacggacaa       780
     ctgtgtgttc atccgggaat ggcaaaaaac acttacggca caggttgctt cctgctgatg       840
     aacaccggta aggatgccgt tcgttccaat cacggattgt tgactaccat cgcctgtggt       900
     ccacgtggtg aaatcaacta tgcactggaa ggtgcggtat tcgttggtgg tgcttccatt       960
     caatggctgc gtgatgaatt gaaactcatc gctgatgcag ccgattccga atacttcgca      1020
     agtaaagtca aagacagcaa tggcgtttat gtcgtgccgg catttactgg ccttggtgcg      1080
     ccatactggg acccttacgc acgtggtgcg attttcggac ttacgcgtgg caccaatagc      1140
     aaccatatta tccgcgccac cttagaatcc atcgcttacc agacccgtga tgtattggat      1200
     gcaatgcaag ctgatgcagg tacacgccta caggctctgc gcgtagatgg tggcgctgtg      1260
     gccaataatt tcctgatgca gttccaggcc gatattctgg gcacgcgcgt ggagcggcct      1320
     gaagtgcgtg aaagtaccgc gttaggtgcc gctttccttg ctggtctggc cgttggtttc      1380
     tggcaagatt tagatgaagt gaaaagtaaa gccaccatag aaaaagaatt ccgcccaggc      1440
     atagaaacaa ctgagcgtaa tcataaatac aacggttgga aaaaagcggt tgcccgtgct      1500
     caagagtggg aagatcgcgc ctaa                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page