(data stored in ACNUC1104 zone)

EMBL: FN667742.GLPT

FN667742.GLPT        Location/Qualifiers
FT   CDS_pept        complement(557576..558928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="XNC1_0645"
FT                   /product="sn-glycerol-3-phosphate transport protein (MFS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88716"
FT                   /db_xref="GOA:D3VJG0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88716.1"
FT                   /translation="MLSIFKPATHKARLPAQEIDPLYRRLRWQIFMGIFFGYAAYYLVR
FT                   KNFTLAMPYLVEQGFSKGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAIMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSIWNC
FT                   AHNVGGGLPPLLFLLGMAWFNDWKAALYMPAFAAILVALIVFALMRDTPQSCGLPAIEE
FT                   YKNDYPPDYTDKDEKELTAKEIFMQYILPNKLLWMIAIANVFVYLLRYGILDWSPTYLK
FT                   EVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMILVTIATTVFW
FT                   MNPAGNPTVDMICMLVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDYMGWDGGFMVMIGGSALSVILLLLVMLSENKHKQEMARLSQ"
     atgttaagta ttttcaaacc ggcgacccat aaagctcggt tgcctgcgca agaaatagat        60
     ccactctatc gtcgcttgcg ctggcaaatt tttatgggga tcttttttgg ctatgccgcc       120
     tactatctgg taaggaaaaa ctttacactg gccatgcctt atttagttga acaaggattc       180
     tccaaaggtg atctcggttt tgccctatca gggatttcaa ttgcatacgg gttctcaaaa       240
     tttatcatgg gctccgtgtc tgatcgttca aatccacgtg ttttcttacc tgcgggtcta       300
     atactcgctg ctgctgtcat gctgtttatg ggcttcgtac cgtgggcaac atccagcatt       360
     gccatcatgt ttgttctact gttcctctgt ggctggttcc agggcatggg ttggcctccc       420
     tgtggacgca ccatggttca ttggtggtca caaaaagagc gtggcggaat tgtttctatc       480
     tggaactgtg cccataacgt tggtggtggt ttaccgccat tattgttcct gctgggtatg       540
     gcttggttca atgattggaa agccgccctg tatatgcctg catttgcggc tattcttgtg       600
     gccctcattg tcttcgcttt gatgcgtgat accccacaat cttgtggttt acccgcaatc       660
     gaagagtaca aaaatgatta tccacctgat tacactgaca aagatgagaa agagctgact       720
     gcaaaagaaa tcttcatgca gtatattctg cctaataagt tgttgtggat gatcgcgatt       780
     gccaacgtgt tcgtatacct tctgcgttac ggtatcctcg attggtcacc tacttacctg       840
     aaagaagtga aacattttgc actggataaa tcgtcctggg cttacttcct gtatgagtat       900
     gcgggtattc cgggtacgct gttgtgcggc tggatgtctg acaaagtgtt caggggaaac       960
     cgtggggcaa ccggtgtatt ctttatgata ttagtgacga tagctaccac ggttttctgg      1020
     atgaaccctg cgggtaaccc aactgtcgat atgatctgta tgctggtcat cggcttcctg      1080
     atttacggcc cagtcatgct gattggttta catgctcttg aactggcacc gaaaaaagca      1140
     gcaggaacag cggcaggttt tacaggtttg tttggttatc tgggcggttc agtagcagcc      1200
     agcgccatcg ttggttatac cgttgactac atgggctggg atggtggctt tatggtcatg      1260
     atcggcggta gcgcactgtc tgttattttg ttgctcttgg ttatgttaag tgaaaataaa      1320
     cataagcagg aaatggcgcg tctgagtcag tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page