(data stored in ACNUC1104 zone)

EMBL: FN667742.GPH

FN667742.GPH         Location/Qualifiers
FT   CDS_pept        complement(60692..61414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="gph"
FT                   /locus_tag="XNC1_0057"
FT                   /product="phosphoglycolate phosphatase, contains a
FT                   phosphatase-like domain"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88145"
FT                   /db_xref="GOA:D3VG55"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88145.1"
FT                   /translation="MLNNVVKKIRAIAFDLDGTLVDSADGLADALDQALIAKGLPAAGK
FT                   DQVAVWIGNGADIMVERALKWAGAEPSPELHRETRKLFDTFYETSITTGSKLFPQVKET
FT                   LAELAKHRLPMAIITNKPTPFIAPLLESLGISEYFSVVLGGDDVKEKKPHPAPLYLTMG
FT                   MFGLHKEELLFVGDSRNDILAAQSAGCPCVGLTYGYNYGESIALSHPTYVLDHFSDLFP
FT                   TIGLSTLNLLSTSKIQEA"
     atgttaaata atgtcgtgaa gaaaatccgg gccattgcgt ttgatctgga tggcacactg        60
     gtggatagtg ctgacggtct ggcggatgca ttagatcagg ccttgattgc taaaggatta       120
     cccgccgcag gtaaagatca ggtcgctgtc tggataggca acggtgctga tatcatggtt       180
     gagcgtgcat tgaaatgggc gggggcggag ccttctcctg aattgcatcg tgaaactcgc       240
     aaactgtttg atacgtttta tgaaaccagc ataacaacag gtagtaagct gtttcctcaa       300
     gtaaaagaga ctctggctga attggcaaaa catcgtttgc ccatggcgat tatcaccaat       360
     aaacccacac cttttattgc tccattactg gaatcattgg gtatcagtga atatttttca       420
     gtggtgctgg ggggtgacga tgtcaaagag aagaaacccc atcccgctcc actctatctc       480
     acaatgggaa tgtttggttt acataaagaa gaattgcttt ttgttggtga ttctcgtaat       540
     gatattttgg ctgcacaatc agcgggttgc ccttgtgttg gcttgaccta tggatataac       600
     tacggagaat cgatagcatt aagccatccg acttatgtgc tggaccattt ttcggattta       660
     ttcccaacga ttggactatc cactttgaac ctattatcca cttcgaaaat acaggaagcg       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page