(data stored in ACNUC1104 zone)

EMBL: FN667742.GYRB

FN667742.GYRB        Location/Qualifiers
FT   CDS_pept        3795..6209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0001"
FT                   /gene="gyrB"
FT                   /locus_tag="XNC1_0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88097"
FT                   /db_xref="GOA:D3VG07"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88097.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCDKIVVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELTIRRDGKVHEQTYHHGVPQSPLNIVGDTEQT
FT                   GTTVRFWPSMDTFKINTEFEYDILAKRLRELSFLNSGVSIRLVDKRTNAEDLFHYKGGI
FT                   KAFVEFLSRNKNPIHPNVFYFSTEKDGIGVEISMQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LVGFRTAMTRTLNSYMDKEGYNKKSKVSATGDDAREGLIAVISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETLMNEKLVEYLLENPNDAKTVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGYVYIAQPPLYKVKKGKQEQYIKDDDAMEAYQMSIALDGAALYTNPHAPGLK
FT                   GEALENLVTEFNTTQKLIHRMERLYPLALLNSLIYHPKLTEDALNDQTKVEEWVSALTI
FT                   RLNDKEQHGSTYSYHIHENRERQVFEPVLCIRTHGVDTNYSLDFDFIHGGEYRRITKLG
FT                   DLIGNLIDEDAYIERGERRQAISSFEHALEWLSKESRRGLSIQRYKGLGEMNPEQLWET
FT                   TMNPETRRMMRVTVKDAIATDLLFTTLMGDAVEPRRAFIEENALKAANIDI"
     atgtcgaata catatgactc ctcaagtatc aaggtattaa aagggctgga tgctgtccgt        60
     aaacgtccag gcatgtatat cggtgatacc gatgatggta ctggtctaca ccacatggtc       120
     ttcgaggttg ttgacaacgc tatcgacgaa gccctcgcag gtcattgtga caaaatagtt       180
     gtcaccatcc atgcagataa ctcagtgtct gtacaggatg atggccgcgg tattcctacc       240
     ggcatacacg aagaagaagg ggtttcagcg gcggaagtta tcatgactgt gctgcatgcg       300
     ggggggaaat tcgatgacaa ctcctataaa gtttccggcg gcctgcatgg cgtaggggtt       360
     tctgttgtta acgccttatc ggaaaaactg gaactgacta tccgtcgtga cggtaaagtc       420
     cacgaacaga cttaccatca tggtgttcca cagtctccgc tgaacattgt cggtgatacc       480
     gagcagacag gaaccacggt tcgtttctgg ccaagcatgg atacgttcaa gattaacact       540
     gaattcgaat acgatattct ggctaagcgc ctgcgtgaat tatcattcct gaattccggt       600
     gtttctattc gtttagttga taaacgcacc aatgccgaag atctcttcca ctataaaggc       660
     ggtatcaaag cgtttgttga gttcctcagc cgcaataaaa acccgattca cccaaatgtt       720
     ttttatttct ccacagaaaa agacggtatt ggtgttgaaa tttccatgca atggaatgat       780
     ggttttcagg aaaacattta ctgcttcacc aacaatattc ctcagcgcga tggcggaacg       840
     cacttagtgg gtttccgtac cgcgatgacc cgaaccctca atagctacat ggataaagag       900
     ggctacaaca aaaaatccaa agtcagcgcc accggtgatg atgcccgtga aggtttgatt       960
     gcagttattt ccgttaaagt acctgatcct aaattctctt cccagacgaa agacaaactg      1020
     gtttcttccg aagtgaaaac ggcggtcgaa acgctgatga atgagaagct ggtggaatac      1080
     ctgctggaaa acccgaacga cgccaaaacg gttgtcggca aaatcattga tgcggctcgc      1140
     gcccgtgaag ctgcacgtaa agctcgtgaa atgacccgtc gtaaaggtgc actggatctg      1200
     gccggtttgc cgggcaaact ggctgactgt caggagcgtg acccggcttt gtccgaactc      1260
     tacctggtgg agggtgattc tgcgggtggt tcagcaaaac aggggcgtaa ccgtaaaaat      1320
     caggcgatcc tgccactgaa aggtaagatc ctgaacgttg agaaagcccg ttttgacaaa      1380
     atgctctctt cacaggaagt cgcaaccttg atcacggcgc tgggctgcgg tattggccgt      1440
     gatgagtaca acccggacaa gctgcgttat cacagcatca tcatcatgac cgatgccgat      1500
     gttgatggtt ctcacatccg taccctgctg ctgaccttct tctatcgcca gatgccggaa      1560
     atcattgagc ggggctatgt ttatatcgct cagccaccac tgtacaaagt gaagaaaggc      1620
     aaacaagagc aatacatcaa agatgacgat gcaatggaag cgtaccagat gtccatcgca      1680
     ttggatggcg cggcgttgta caccaacccg catgctccgg ggctgaaagg tgaagcattg      1740
     gaaaatctgg tgactgagtt caacacaacc cagaaactca tccatcgtat ggagcgcctg      1800
     tatccgctgg ctctgctgaa cagtctgatt taccatccta aactgaccga agatgcactg      1860
     aatgatcaga caaaagtgga agaatgggta agcgcgctga ctattcgttt gaatgacaaa      1920
     gaacagcatg gcagcactta cagctatcac atccatgaga accgtgaacg ccaggttttc      1980
     gagccagttc tgtgcattcg tacacatggt gttgatacca actacagtct ggatttcgat      2040
     ttcatccacg gtggcgaata ccgccgcatc accaaactgg gtgatttgat cggaaacctg      2100
     attgatgaag atgcatatat tgaacgtggt gaacgccgtc aggcaataag cagctttgag      2160
     catgcgctgg agtggctgag caaagagtca cgccgtggtc tttccatcca acgttataaa      2220
     ggtctggggg aaatgaaccc agagcagttg tgggaaacaa ccatgaaccc ggaaacgcgt      2280
     cgtatgatgc gtgtcaccgt gaaagatgca attgccactg acctgctgtt cacaaccctg      2340
     atgggtgatg cagttgaacc tcgtcgggca tttattgaag aaaatgctct gaaagcagcg      2400
     aatattgata tttaa                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page