(data stored in ACNUC1104 zone)

EMBL: FN667742.HEMY

FN667742.HEMY        Location/Qualifiers
FT   CDS_pept        complement(334766..335971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0074"
FT                   /gene="hemY"
FT                   /locus_tag="XNC1_0402"
FT                   /product="protein in late step of protoheme IX synthesis
FT                   with TPR-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88479"
FT                   /db_xref="GOA:D3VHZ0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88479.1"
FT                   /translation="MLKILLLFIILIVGIILGPVMSGHQGYVLIQTDSNNITTSITAVV
FT                   IMFLLLQFLLIFIGWCYRRLKRTSTSTHSWIFGGFKRNRARSQTRQALLKLAEGDFKQV
FT                   EHLMTRNADHAEYPVVNYLLAAEAAQQRGDYFHTNQYIERAAEVADKDQLPVDISRVRI
FT                   QLAQGEIHAARNGVDKLLNHAPRHPEVLRLAERAYSLSGAYQALIDVLPSMIKAKLYDE
FT                   EKIHAIRQQAYVGLMNQVFAEKGCTGLKAWWKDQGRKIRQDIVLQVVMAEHLIACNDHD
FT                   TAQQIILDGLKQQYDERLLLLIPHLKANDAEAIQKNLTHLLKQHGATPLLNSTMGQVAL
FT                   RHGEWANAEAAFKAALAQRPDAHDYAWLADALDKLQKHEEATQTRSKGFMLTLKRDSNT
FT                   GA"
     atgctgaaaa tattattgct tttcattatc ctcattgtgg gtattatact tggcccggtg        60
     atgtctgggc atcaaggata cgttctgata cagacggaca gtaacaatat caccaccagc       120
     attaccgcgg tggtcattat gttcctctta ttgcaattcc tgctgatttt catcggctgg       180
     tgctatcgcc ggttaaaacg taccagcacc tccactcata gctggatctt tggtggcttc       240
     aaacgcaatc gggcacgttc acaaaccaga caagcgctgt tgaaactcgc tgaaggcgat       300
     ttcaaacagg ttgagcatct gatgacccgc aatgctgatc atgcggaata tcctgtcgtg       360
     aactatttac tggccgcaga ggccgcccaa cagcgtggtg attatttcca taccaaccaa       420
     tatattgaac gtgccgcaga agttgctgat aaggatcagc tccctgtcga tatttctcgt       480
     gtacgtatcc agttggcgca aggtgaaatt catgccgcac gtaatggtgt ggataagctt       540
     ctgaatcatg cccctcgcca tcctgaagta ttgcgattgg ctgagcgagc ttattctctt       600
     tccggggctt atcaggcatt gatcgatgtc ttaccttcaa tgataaaggc caagttgtat       660
     gatgaagaaa aaattcatgc aatacgccag caagcttacg tcgggttaat gaatcaggtt       720
     ttcgctgaaa aaggctgcac agggctaaaa gcctggtgga aagaccaggg ccggaaaatt       780
     cgccaggata tcgtactgca agtcgtcatg gccgaacatt tgattgcctg caatgatcat       840
     gatactgccc aacaaatcat tttggatggg ttaaaacagc aatatgatga acgtctcctg       900
     ctattgattc cacaccttaa ggcgaatgat gctgaagcaa tacaaaagaa cctcactcat       960
     ctgttaaaac aacatggagc aaccccttta ctcaacagta caatgggaca agttgccttg      1020
     cgtcatggtg aatgggccaa tgctgaagca gcatttaagg ccgcacttgc ccaacgaccc      1080
     gatgcccatg attacgcatg gcttgctgat gcactcgata aattgcagaa acacgaagag      1140
     gccacgcaaa cacgtagcaa aggctttatg ctgaccctga aacgcgatag caatacagga      1200
     gcataa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page