(data stored in ACNUC1104 zone)

EMBL: FN667742.HFLX

FN667742.HFLX        Location/Qualifiers
FT   CDS_pept        389804..391084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0083"
FT                   /gene="hflX"
FT                   /locus_tag="XNC1_0456"
FT                   /product="putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain, together with HflC-HflK
FT                   involved in stability of phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88530"
FT                   /db_xref="GOA:D3VII0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88530.1"
FT                   /translation="MFDRYEGGELAVLVHVFFSQEKDTENLSEFESLVTSAGVSPVQIV
FT                   TGSRKAPHPKYFVGEGKAEEIAEAVKNSGADVVLFNHTLSPAQERNLERLCQCRVVDRT
FT                   GVILDIFAQRARTHEGKLQVELAQLRHLSTRLVRGWTHLERQKGGIGLRGPGETQLESD
FT                   RRMLRDKIKQILGRLSKVEKQREQGRQARNKADIPTVSLVGYTNAGKSSLFNSITSAKV
FT                   YAADQLFATLDPTLRRIDVDDVGTVVLADTVGFIRHLPHDLVAAFKATLQETRQAKLLL
FT                   HVVDAADHRLDENIIAVDSVLEEIESNEIPSLMVMNKIDMLEDFTPRIDRDEENRPVRV
FT                   WLSAQTGEGISLLLQALTERLSGETAHYELHLPPEAGRLRSRFYQLQAIEREWMEEDGQ
FT                   VGLEVRMPMVDWRRLCKQEPNLPDYVV"
     ttgtttgatc gttatgaagg cggagaatta gctgttctgg tgcatgtttt cttctcacag        60
     gaaaaagata cggaaaatct cagtgaattt gaatcattgg tgacttccgc tggtgtttct       120
     cctgtgcaga ttgtaacggg aagccggaag gcacctcatc caaaatattt tgtcggtgag       180
     ggcaaagcag aggaaattgc cgaagctgtt aaaaatagcg gcgcagatgt ggtgctgttt       240
     aaccataccc tcagccctgc tcaagaacgt aatcttgaac gcttgtgcca atgccgtgtt       300
     gttgatcgta ccggggttat tctggatatt tttgcccagc gggcaagaac acacgaaggc       360
     aagctgcaag ttgaattggc tcagttgcgt catctatcga ctcgcctggt ccggggctgg       420
     acgcaccttg aacgtcaaaa aggcgggatc ggcctgcgtg gtccggggga aacccagcta       480
     gaaagtgacc gtcgcatgtt gcgtgacaaa atcaaacaga ttctggggcg cctcagcaaa       540
     gttgagaaac agcgcgaaca agggcgtcag gcacgtaata aagccgatat tcccactgtt       600
     tcccttgttg gttataccaa tgcaggaaaa tcaagcctat tcaacagcat aacttcagcc       660
     aaagtttatg ccgccgatca gctgtttgcc acccttgacc cgacattgcg ccgaatagat       720
     gtcgatgatg ttggtactgt tgttttggcg gatacggtag gttttatccg tcatttgccc       780
     catgatttgg tggcagcatt caaggcgacc ttacaagaaa cccgacaagc gaaattgttg       840
     ctgcatgttg ttgatgcggc tgatcatcgt ctggatgaaa atattatcgc tgtagacagt       900
     gtccttgaag aaattgaatc aaatgaaatt ccttctctga tggtcatgaa taaaatcgat       960
     atgttagaag attttactcc gcgcattgac cgtgatgagg aaaatcggcc tgtcagagtt      1020
     tggttatctg cccaaactgg tgaaggtatt tcattattac tgcaagcatt aaccgaacga      1080
     ctttcaggtg aaaccgctca ctatgagttg catcttccgc cagaagcggg gcgtttgcgc      1140
     agccgttttt atcagcttca ggcgattgaa cgcgagtgga tggaagagga tggtcaggtc      1200
     gggcttgaag tcagaatgcc gatggtagac tggcgtcgtt tgtgtaaaca agaaccaaat      1260
     ttacctgact atgttgtctg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page