(data stored in ACNUC1104 zone)

EMBL: FN667742.HSDM

FN667742.HSDM        Location/Qualifiers
FT   CDS_pept        complement(20538..22997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /gene="hsdM"
FT                   /locus_tag="XNC1_0020"
FT                   /product="Type I restriction-modification enzyme subunit M"
FT                   /EC_number="2.1.1.72"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8566812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88113"
FT                   /db_xref="GOA:D3VG23"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88113.1"
FT                   /translation="MAIKKNELYSSLWASCDELRGGMDASQYKDYVLTMLFMKYVSDKY
FT                   KNDRYGIIVIPEGASFDDMVALKGKKEIGDKINKIIRKLADENRLGTMFDVANFNDEEK
FT                   LGKGKEMIDRLSKLVGIFEGLDLSNNYAGGDDLMGDAYEYLMRHFATESGKSKGQFYTP
FT                   AEVSLVLAKIIGINDKTPRDASVYDPTCGSGSLLLKASDEAPRGLSIFGQEMDVTTSSL
FT                   AKMNMILHGHESDVHSIQQGNTIASPVFKDDKGQLKTFDFAVANPPFSNKNWTSGINPR
FT                   EDEFGRFGWGIPPEKNGDYAFLLHILKSLKSTGKGAVILPHGVLFRGNAESLIRENLIK
FT                   QGYIKGIIGLPANLFYGTGIPACIIVLDKQDAISADFDAEGKVTRGRDIFMIDASRGFI
FT                   KDGNKNRLRSQDIYKIVEVFTQQKTLPRFSRVVEFKEIVENDYNLNIPRYIDSSEPEDL
FT                   HDLSAHLQGGIPNRDIDALDKYWNIFPDIRSTLFAPEREGYSRSLVDANQVKNTILSHA
FT                   EFKTFAEQSLKPFATWCQSAALKEIRLKDKPKELIHEISEALLIRYESLPLLSKYDVYQ
FT                   ILMDYWAETMQDDVYVLVQDDWKAGKKVRELVVKQAEKLKETPDFVIKKTKYKAEIIPP
FT                   ALIIQNYFAGQQVKIDQLQIDADNATQALENYIEENSGDDGLLNDALNDKDKVTKASIA
FT                   ARLKLATDNEEKTVLKQAKELFDAEIDAKKALKKYQEALDLSVLKQYSKLTDDEIKTLV
FT                   VDKKWLATLEANIQAEIERVTQQLTNRVRELEERYAEPLPKINESVEEISKKVAEHLKD
FT                   MGLEWTL"
     atggcaatca aaaagaacga actctattcc tcattgtggg ctagctgcga tgagctgcgt        60
     ggcggtatgg atgccagcca gtacaaagac tacgtactga ccatgctgtt tatgaagtat       120
     gtgtccgata agtacaaaaa tgatcgttac ggcattattg ttattcctga aggtgccagt       180
     tttgacgata tggttgctct gaaaggcaag aaagaaatcg gtgataaaat caataagatt       240
     atccgcaaat tagctgatga aaatagatta ggaaccatgt ttgatgttgc caactttaac       300
     gatgaagaaa agcttggtaa aggcaaagag atgattgacc gcctttccaa actggtcggt       360
     atttttgaag ggttggatct ctccaataat tatgctggtg gcgatgattt aatgggtgat       420
     gcctatgaat atctgatgcg ccacttcgca actgaatctg gcaaatcaaa aggacagttt       480
     tatactcctg cggaagtttc gttagttctg gcaaagatta taggaataaa cgacaaaact       540
     ccgcgtgatg cttctgtgta tgacccaacc tgcggttcag gttctttgct tcttaaagcg       600
     agtgatgaag caccgcgtgg attaagtatc tttggtcagg agatggatgt gaccacttca       660
     tcactggcaa aaatgaatat gattctgcat ggtcatgaat ctgatgttca tagtattcag       720
     cagggtaaca ccattgcctc tcctgtattt aaagatgata aaggacagct taaaactttt       780
     gatttcgccg tagcgaatcc tcctttttct aataaaaact ggaccagtgg tattaacccg       840
     agagaagatg aatttggtcg ttttggttgg ggaattccac cagagaaaaa cggtgattat       900
     gcctttttat tgcacatcct caagagcctg aaaagtacag gtaaaggggc tgtaatcttg       960
     cctcacggtg tattgtttcg tggtaatgct gaatccctga ttcgtgaaaa cctgataaag      1020
     cagggttaca ttaaaggtat tattggtctt ccggcaaacc tgttttatgg cacagggatt      1080
     ccggcctgta ttattgtgct ggataagcag gatgccattt ctgctgattt tgatgcagaa      1140
     gggaaagtta cccgtgggcg tgatattttt atgattgacg caagccgggg ttttataaaa      1200
     gacggcaaca aaaaccgtct gcgcagtcag gatatttaca aaattgttga agtttttact      1260
     caacagaaaa cattgccacg ttttagccga gtagttgaat ttaaagagat agtagagaac      1320
     gactacaacc tcaatatccc tcgttatatc gacagtagtg aaccggaaga tttgcacgat      1380
     ctcagtgctc atctgcaagg ggggattcct aaccgtgata ttgacgcgtt ggataaatac      1440
     tggaatattt ttcccgacat tcgctccaca ctatttgcac cagagcgcga ggggtacagc      1500
     cgcagcttag tagatgccaa tcaggtgaaa aacacgattc tcagtcatgc agaatttaaa      1560
     actttcgcgg aacaaagcct gaaaccgttt gccacatggt gtcaatctgc tgcattgaaa      1620
     gaaatccgtc ttaaagataa acctaaagag ctgattcatg aaatcagtga agctttgttg      1680
     attcgttatg aatcattgcc gctgttgagc aagtacgatg tttaccagat cctgatggat      1740
     tattgggcag agacgatgca ggacgatgtt tatgtgctgg tacaagatga ttggaaagca      1800
     ggtaaaaagg tacgtgagct ggtagtaaaa caagctgaaa aactgaaaga aactccggat      1860
     tttgtgatca aaaaaactaa gtacaaagct gaaattattc ctccggcatt gattatccag      1920
     aattactttg cagggcaaca ggtaaaaatc gatcaattac aaattgatgc ggataatgca      1980
     acacaagcgc tagaaaacta tatcgaagaa aacagcggcg atgatggcct gctgaatgat      2040
     gccctgaatg acaaagataa agtgaccaaa gcaagtattg ctgctcgcct gaaactggca      2100
     actgacaatg aagaaaaaac agtactgaaa caggcaaaag agctatttga tgctgaaata      2160
     gacgctaaaa aagcgctgaa aaaatatcag gaagctctgg atttatcggt acttaagcaa      2220
     tactcaaaac tcactgatga tgagatcaaa acgttggtgg tggataagaa atggctggca      2280
     acattggaag ctaatattca ggctgagatt gagcgtgtaa ctcaacaact gacaaaccgt      2340
     gtcagagaac tggaagaacg ctatgccgag ccgctgccta aaattaacga atcagttgaa      2400
     gaaataagca aaaaagttgc cgaacacctg aaagatatgg ggttagaatg gacgttgtga      2460
//

If you have problems or comments...

PBIL Back to PBIL home page