(data stored in ACNUC1104 zone)

EMBL: FN667742.HSDS

FN667742.HSDS        Location/Qualifiers
FT   CDS_pept        complement(19192..20550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /gene="hsdS"
FT                   /locus_tag="XNC1_0019"
FT                   /product="Type I restriction-modification enzyme subunit S"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8566812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88112"
FT                   /db_xref="GOA:D3VG22"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88112.1"
FT                   /translation="MDVVTVEQVLEIRDKDITEIADTIIPVGYKKTEVGVIPEDWDAVF
FT                   FGDLFEDKLPRKALKSNDDVIFIGMQDLSENAQLLSQHKVKYGSLKGGLTYFEKGDVLV
FT                   AKITPCFENGKGCHTKNLLTEIGIGSTEFHVLRATKHTNADFIYFWTTKKYFRKTLESE
FT                   MVGSAGHKRVPLQAIQNFLLPCPRNNIEQIAIANTLSDIDVLISELETLLAKKQAIKTA
FT                   TMQQLLTGRTRLPQFALCENGSKKGYKQSELGEIPEDWEIICIKDVGFVDPENLGSTTS
FT                   LDYKFDYISLEQIDAGVLLGTVKCTFNTAPLRARRVLQQGDVLISTVRPNLMSHYFVRE
FT                   DVRDLVCSTGFSVVRCLKDKLRPGYLYQHFFSAVINNQIDMLISGSNYPAINSSDVKNL
FT                   KIQLGSVNEQTAIATILSDMDTEIQALEQKLDKTRQIKQGMMQELLTGKTRLI"
     atggacgttg tgacggtgga acaggtatta gaaatcagag ataaggatat aactgaaata        60
     gcagatacca ttatacctgt gggttataag aaaacggaag tcggagtgat cccagaggac       120
     tgggatgctg tcttttttgg tgacctattt gaagataaac tcccccgaaa agcattgaaa       180
     tcaaatgatg atgtcatttt tattggtatg caagatttat cagaaaatgc tcagctttta       240
     tcgcaacaca aggtgaaata tggctcttta aagggcggct taacttattt cgaaaaaggt       300
     gatgtattag tagcaaagat aacaccatgt tttgagaatg gtaaagggtg tcatacaaag       360
     aacttgttaa ctgaaatcgg cattggtagc accgaattcc atgttcttag agctacaaaa       420
     catactaatg ctgattttat ttacttttgg acgactaaaa agtatttcag aaaaacactc       480
     gaatctgaga tggtaggaag tgcagggcac aaaagggttc ctttgcaagc catacaaaac       540
     tttttattac cctgtcctag aaataatata gaacaaattg ctattgccaa cactctgtcc       600
     gatatcgatg tgctgatcag tgagctggaa actctactag caaaaaagca agccatcaaa       660
     acagcaacca tgcagcagtt gctaacaggt cgtactcgct tgccacagtt tgctttgtgt       720
     gaaaatggct cgaaaaaagg gtataagcaa agcgaattag gagagattcc tgaggattgg       780
     gagattatat gtataaagga tgttggtttc gttgaccctg aaaatttagg ttcaacaaca       840
     tcactagatt ataaatttga ttatatttct cttgagcaaa tagacgctgg ggttcttttg       900
     ggtactgtta aatgtacttt taatacagct ccattaagag caagacgtgt gttacagcaa       960
     ggtgatgtat tgatctcaac tgttagacct aatctgatgt cacactattt cgtccgagag      1020
     gacgtaagag atttagtttg ttcgacaggt ttcagtgtgg ttaggtgctt aaaagataag      1080
     ctgcgtcctg gttacctata tcaacatttt ttctcagcgg tgatcaataa tcaaattgat      1140
     atgctgattt ctggttctaa ttatccagca atcaacagtt cagatgttaa aaacttgaaa      1200
     attcaattag gcagtgttaa tgagcaaacc gccatcgcca caatcctctc ggatatggat      1260
     acagaaatcc aagcacttga acagaaactg gataaaactc gtcaaattaa acaaggcatg      1320
     atgcaagagc tactcactgg taaaactcgt ctgatataa                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page