(data stored in ACNUC1104 zone)

EMBL: FN667742.HUPA

FN667742.HUPA        Location/Qualifiers
FT   CDS_pept        532072..532344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0116"
FT                   /gene="hupA"
FT                   /locus_tag="XNC1_0621"
FT                   /product="DNA-binding protein HU-alpha (HU-2), plays a role
FT                   in DNA replication and in rpo translation"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88695"
FT                   /db_xref="GOA:D3VJD9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88695.1"
FT                   /translation="MNKTELVDAIAAGADLTKTQAKAALESTLNAITESLKNGDAVQLV
FT                   GFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFSAGKALKDAVK"
     atgaataaga ccgaattagt tgatgcaatt gcagcaggcg cagatctgac taaaactcag        60
     gctaaagctg ctctggagtc aactttgaat gcaatcactg aatccctgaa aaatggcgat       120
     gcagtgcagc tggtaggctt tggtactttc aaagttaacc accgtgcaga acgtactggc       180
     cgtaacccac agactggtaa agaaattaaa attgcggcag ccaacgtacc tgctttctct       240
     gctggtaaag cactgaaaga cgcagttaag taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page