(data stored in ACNUC1104 zone)

EMBL: FN667742.ILVM

FN667742.ILVM        Location/Qualifiers
FT   CDS_pept        301066..301323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /gene="ilvM"
FT                   /locus_tag="XNC1_0369"
FT                   /product="acetolactate synthase II, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88446"
FT                   /db_xref="GOA:D3VHV7"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88446.1"
FT                   /translation="MMQHQLAIQARFCPEILERILRVTRHRGFQICALNMDQTTDSGNV
FT                   SIELTVSSQRSINLLFSQLMKLVDVAGIEIKHKESQLISA"
     atgatgcagc atcaacttgc tattcaggca agattttgtc ctgagatttt ggagcgaatt        60
     ctgagagtta cccgccatcg tggatttcag atatgcgcat tgaatatgga tcagacaaca       120
     gatagtggta atgtaagtat tgaacttact gtatccagcc agcgttcgat taatttgctt       180
     ttttcccaat tgatgaaatt agttgatgtt gctggtattg agatcaaaca caaagaatca       240
     caattaataa gcgcataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page