(data stored in ACNUC1104 zone)

EMBL: FN667742.MENG

FN667742.MENG        Location/Qualifiers
FT   CDS_pept        complement(190433..191005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0045"
FT                   /gene="menG"
FT                   /locus_tag="XNC1_0217"
FT                   /product="putative methyltransferase protein in menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88305"
FT                   /db_xref="GOA:D3VH20"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88305.1"
FT                   /translation="MILPTLTLKGYTVCSLHKPDVNPMKYDTSELCDIYQEDINVVEPL
FT                   FSNFGGRTSFGGQIITVKCFEDNGLLYDLLEENGHGRILLVDGGGSVRKALVDAELAQL
FT                   AANNEWEGIVVYGAVRQVDYLSELDIGIQAMAAIPAGSNSEGVGESDIRVNFGGVTFFS
FT                   GDYLYADNTGIVLSDVPLELDEDNDDV"
     atgattttgc caacattgac tctaaaagga tatactgtct gctccttgca taaaccagac        60
     gtaaatccca tgaaatatga tacttccgaa ctttgtgata tctatcaaga agatataaat       120
     gtggtagaac cactattttc caactttggt gggcgtactt catttggtgg tcagatcatc       180
     acggtgaaat gctttgaaga caatggcctg ctgtatgatt tacttgaaga aaatgggcat       240
     ggtcgcattt tgctcgttga tggtggtggc tcagtacgca aggcactagt tgatgccgaa       300
     ctcgctcaac tggctgccaa taatgagtgg gaaggcattg tcgtctatgg cgcagtccgt       360
     caggtcgatt atctttctga gcttgatatt ggcattcaag caatggctgc cattcctgct       420
     ggttctaaca gtgaaggtgt gggagaaagt gatatcagag tcaacttcgg tggtgtgact       480
     ttcttctctg gcgactatct ctatgcagat aatacaggca tcgtcttatc agatgttccg       540
     ctggagcttg acgaagacaa cgacgacgtg taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page