(data stored in ACNUC1104 zone)

EMBL: FN667742.MRCA

FN667742.MRCA        Location/Qualifiers
FT   CDS_pept        69562..72072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="XNC1_0068"
FT                   /product="bifunctional penicillin-binding protein 1a:
FT                   transglycosylase (N-terminal); transpeptidase (C-terminal)"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88156"
FT                   /db_xref="GOA:D3VG66"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88156.1"
FT                   /translation="MILIVVCILLGTASIFGLYKYIEPQLPDVATLKDVRLQTPMQVFS
FT                   ADDELIAQYGEKRRLPLTLSEMPPLMVKAFIATEDSRFYEHHGVDPIGIIRAVSVVMTS
FT                   GHATQGASTITQQLARNFFLSPEKTLIRKAKEAFLAIKIEQLLTKDEILELYLNKIYLG
FT                   QRAYGIGAAAQVYFGKTVNELTLSEMAMIAGLPKAPSTFNPLYSYDRAMSRRNVVLGRM
FT                   LEEGYITQRQYNEAREEKLVARYHGPQIVFSAPYLTEMARQEIINRYGENAYTDGYKVY
FT                   TTITRKAQLAAVNAVRTNVIDYDIRHGYRGAQEVLWKASQPAWDQALIINKLKTLPKYG
FT                   PLVPAVVTGSSANQAEAMLVDGSKVELTMAGVRWARSFKTDSLQGPVPRRVNDVIHAGE
FT                   QIWVRKVNDIWWLAQLPQVNAALVSINPLNGAVEALVGGFNFELSKFNRVTQSLRQVGS
FT                   NIKPFLYTAAMDKGLTLASLLNDAPISRWDAGAGTDWRPKNSPPTYDGPVRLRQGLGQS
FT                   KNVVMVRAMRAMGVDYAADYLKRFGLPGENVVRTESLALGSPSFTPMQLVRGYAVMANG
FT                   GYLVDPYFIARIENEEGNVLFEAKPKLACPQCENIPVIYGETARSIELSEDSIENVAHS
FT                   DEPQDSALPPQPDLERVSANTDVDDQQYAPHVISTPLAFLIHDALNTNVFGEPGWMGTG
FT                   WRAARDLKRRDIGGKTGTTNSSKDAWFSGYGPDIVATAWIGFDEHSRSLGRTPALKGEG
FT                   GAKTAQPIWDDFMKVALEGVPEKIMEPPAGIVSVTIDRATGKLSSGGGNTRKEYFIEGT
FT                   QPTEYAVPDVGTTVTENGESHELF"
     ttgatcctta tcgttgtttg cattttattg ggaactgcct cgatttttgg tttgtacaaa        60
     tatatcgagc cacagctgcc tgatgttgca actttaaagg atgtccgatt acaaacaccg       120
     atgcaggtgt tcagtgctga tgacgaattg atcgcccaat atggtgaaaa gcgtcgttta       180
     cccctaacct tatccgaaat gccccctttg atggtgaaag ccttcattgc gacggaagac       240
     agccgttttt atgaacatca cggtgttgat ccgatcggca ttattcgtgc ggtttccgtc       300
     gtgatgacgt caggtcatgc cactcaggga gcaagtacta tcactcaaca gctggcgaga       360
     aacttttttc tcagcccaga aaagacgttg atacgtaagg caaaagaagc ctttctggcc       420
     attaagattg aacagctgtt aacgaaggat gaaatccttg agttgtacct caacaagatc       480
     tatctgggac agcgtgccta tggtatcggt gctgcggctc aggtctattt tggcaagaca       540
     gtgaatgaac tgacgttgag tgagatggcg atgatcgccg gattgccgaa agcgccttca       600
     acatttaacc cgctttattc ctatgaccgt gcgatgagcc gccggaatgt ggtattggga       660
     cggatgctgg aagaaggcta tatcacccag cgccaataca acgaagccag agaagagaaa       720
     ttggttgccc gttatcatgg cccacaaatt gttttctctg cgccttatct gacggagatg       780
     gcgcgtcagg aaattatcaa ccgttacggt gaaaatgctt ataccgatgg gtataaggtc       840
     tatacaacaa ttacgcgcaa agctcagttg gctgcggtta atgcggtgcg taccaatgtg       900
     attgattatg atattcgtca tggttatcgc ggtgcacagg aagtgttgtg gaaggcgagt       960
     cagccagcct gggatcaggc actgattatc aataagctga aaacgttgcc taaatatggt      1020
     cctctggtgc ctgcggttgt gacaggctcc agcgccaatc aggcagaagc catgctggtg      1080
     gatggcagta aagttgaact gacgatggca ggtgtccgtt gggcacgttc attcaaaacc      1140
     gacagtctgc aagggcctgt gccacgccgt gtcaatgacg tcattcatgc gggtgaacag      1200
     atttgggtca gaaaagtcaa tgatatctgg tggctggccc aactccctca agtcaatgca      1260
     gcgctggttt ccatcaatcc gctaaatggt gcggtagaag cgttggtggg cgggtttaat      1320
     tttgaactga gtaaatttaa ccgggtgacg caatcactgc gtcaggttgg ttccaacatc      1380
     aagccattct tgtataccgc tgcgatggat aaaggtctga cactggcatc actgctgaat      1440
     gatgcgccca tcagccgttg ggatgcgggc gctggaacag actggcgtcc gaaaaactca      1500
     ccgccgactt acgatggtcc ggttcgtctg cgtcagggat tggggcaatc gaagaacgtg      1560
     gtgatggtgc gtgccatgcg cgcgatgggg gtggactacg cggctgatta cctgaaacgc      1620
     ttcggattgc cgggcgaaaa cgttgtgcgc acagaatcct tggcgctggg ttccccgtcg      1680
     tttacgccga tgcagttagt ccgcggttat gcggtaatgg caaatggggg ttatttggtt      1740
     gatccttatt tcattgccag aattgaaaat gaggaaggga acgtgctgtt tgaagccaag      1800
     cctaaactgg cgtgtccgca atgtgaaaat attccggtga tttatggtga aactgcacgt      1860
     tccatcgaat tgtctgaaga ttccattgag aatgtggctc attccgatga accccaagat      1920
     tcagctttgc ctccccagcc tgatttagag cgtgtttcgg caaatactga cgttgatgac      1980
     cagcaatatg cgcctcatgt tatcagcaca ccgctggcat ttttgatcca tgatgccctg      2040
     aataccaatg tctttggtga accgggttgg atgggtacag gctggcgcgc tgcccgtgat      2100
     ttgaagcgtc gcgatatcgg cggtaaaaca ggcacgacca acagttcgaa agatgcgtgg      2160
     ttctccggtt atggcccgga tatagtggcg acagcctgga ttggctttga tgagcacagc      2220
     agaagtctgg gacgcacgcc ggcattgaaa ggtgaagggg gagcgaagac ggctcagcca      2280
     atttgggatg atttcatgaa agtggcgctg gaaggtgtgc ctgagaaaat aatggaaccg      2340
     cctgccggta ttgtttctgt cacgattgat cgggcgacgg gtaagttatc cagcggtggc      2400
     ggtaataccc gtaaagaata tttcattgaa gggacacagc cgacagaata tgccgtgccg      2460
     gatgtgggga caacagtcac cgagaatggt gaaagccatg agttgttctg a               2511
//

If you have problems or comments...

PBIL Back to PBIL home page