(data stored in ACNUC1104 zone)

EMBL: FN667742.MUTL

FN667742.MUTL        Location/Qualifiers
FT   CDS_pept        386440..388362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0082"
FT                   /gene="mutL"
FT                   /locus_tag="XNC1_0453"
FT                   /product="enzyme in methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88527"
FT                   /db_xref="GOA:D3VIH7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88527.1"
FT                   /translation="MAIKILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGISQQDLTLALARHATSKIASLDDLEAIMSMGFRGEALASISS
FT                   VSRLTLTSRPENQTEAWQSYAEGRDMEITVKPAAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFGHIDEVVRRIALARLDIAINLNHNGKLVRQYRPAKEESQYERRLAAICGTAFVQ
FT                   QALALSWQHDALLIKGWIADPMSTTTGSDIQYCYVNGRMMRDRLINHAIRQAYQDLIQG
FT                   EQQPAYVLYLEIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQGVAAVLKQRSKGDELAL
FT                   GCQEPTEHWVPENRPSAGENHFLRKKIVPADSVSARHHDNDNIRQREPDKRQPLGREAP
FT                   PLHHGESYQKKQGDLYQKLMQFAPEEKQPLFPERAASASSSSVQSSLEKNSNASSGYHH
FT                   SFGKILSIYAGCYALLESSIGIGLLSLPVAERWLKQAQLTPGEQGLKSQPLLIPLKLAL
FT                   NQAEMGSLKQNSELLKTFGIESTSANGKVTIHAVSLPLRQQNLPKLLPELLGYLGEQSV
FT                   VSAEQIAIWLSRHLGSEHETWNVAQAVQLLADVERLCPQLVGSPPEGLLQLIDLQAVVA
FT                   LLNHE"
     atggctatca agatattacc cccacaattg gcaaaccaga ttgctgccgg tgaagtggtt        60
     gaacgccctg cgtctgtggt gaaagagctg gtggaaaata gccttgatgc cggcgctaca       120
     cgtattgata ttgatattga gcggggaggc gcaaagttaa tccgcattcg tgataacgga       180
     tgcgggatca gtcagcagga tctcacattg gcgttagcac gtcatgccac cagtaaaatt       240
     gcttcactgg atgatctgga agcgattatg agcatgggtt ttcgtggcga agcactggcg       300
     agtatcagtt ctgtctcacg gctgacattg acttcccgtc ctgaaaacca gaccgaagca       360
     tggcaatctt atgctgaagg ccgggatatg gaaatcacgg ttaaacctgc tgctcacccg       420
     gtagggacaa cagttgaagt attggatctg ttttataaca cgcctgcccg ccgtaaattt       480
     ctcagaacgg agaaaacgga gttcggtcat attgatgaag tggttcgccg aattgcactg       540
     gcccggctgg atatcgccat taaccttaat cacaacggga agctggtgcg tcaatatcgt       600
     ccggcgaaag aagaatcgca atatgaacgg cgtttggccg ctatttgtgg tactgcgttt       660
     gtacagcaag ccttagcgtt gtcatggcag catgatgctt tgttgattaa agggtggatt       720
     gctgacccca tgagtaccac aacagggagt gatatccaat attgctacgt taatggacgc       780
     atgatgcggg atcggctaat taatcatgcc attcgtcagg cctatcagga cttgattcag       840
     ggtgaacaac aacccgctta tgttttgtat cttgagattg atccgcatca ggtagatgtg       900
     aacgtacatc cggctaaaca cgaagtgcgt ttccatcagg cgcggttggt gcacgatttt       960
     atttatcaag gtgtggcggc ggtattgaaa cagcgcagta agggagatga gctggcgctg      1020
     ggttgtcagg aaccaactga acattgggtg ccggagaatc gtccttcagc gggcgaaaat      1080
     cattttctca gaaagaaaat cgtaccagca gattcagtct ctgcccggca tcatgataat      1140
     gacaatatca ggcaacgaga gccagacaaa cgtcagccat tgggtcgtga ggcaccacca      1200
     ttgcaccacg gggaaagcta tcagaaaaaa cagggagatc tgtatcagaa actgatgcag      1260
     tttgcaccgg aagaaaagca gcccctgttt ccggaaagag cagcttctgc ttcatcctca      1320
     tcagtgcaat caagtctgga gaaaaacagc aatgccagtt ctggctatca ccatagcttt      1380
     gggaaaatat tgagtatcta tgccggctgt tatgcgttgc ttgaatcttc aatcggcatt      1440
     gggttgctct ctctgccagt tgcagagcgc tggttaaaac aggcgcaatt gacgccggga      1500
     gaacaggggc ttaaatccca gccattgctg attccgttga agcttgctct caatcaggca      1560
     gaaatgggca gtttgaagca gaacagtgag ctattgaaga cttttggcat tgaatctaca      1620
     tccgcgaatg gaaaagtaac cattcatgcg gtatcgttgc ctttgcgcca acagaacctg      1680
     cctaaacttt tgccggaact gttgggttat cttggagagc agtcagtggt ttctgctgag      1740
     cagattgcaa tctggctctc tcgtcattta ggtagtgaac atgaaacgtg gaacgtcgca      1800
     caagctgttc agcttttggc tgatgtcgag cgtctttgtc ctcaattggt gggatcacca      1860
     ccagaaggat tattacagtt aattgattta caagcagtgg tggcacttct taatcatgag      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page