(data stored in ACNUC1104 zone)

EMBL: FN667742.NLPI

FN667742.NLPI        Location/Qualifiers
FT   CDS_pept        442339..443223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="XNC1_0510"
FT                   /product="NlpI lipoprotein believed to be involved in cell
FT                   division with transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88584"
FT                   /db_xref="GOA:D3VIN4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88584.1"
FT                   /translation="MNSFLRWCYVVAIFLLVGCSNTGWRKNEIIAIPLQPTLQQEVILA
FT                   RMEQILASRSLTEDEYAQLLYERGVLYDSLGLRALAQNDFSVALSIRPDIPEIFNYLGI
FT                   YFTQAGNFDSAYEAFDSVLELDPTYNYARMNRGIALYYGGRYRLAQDDLQAFYQDDPND
FT                   PFRSLWLYLVEAKIDPKVAMTNLSHHFDKANRGLWGWNIAEFYLGKISEKILMERLQQN
FT                   SADNTSLAEHLSETDFYLGKHYLSLGDEDSAVALFKLTVANNVHYFVEHRYALLELALL
FT                   SQRQDDLSESNQQ"
     atgaattctt ttctgcgctg gtgttatgtt gtggctattt ttctcctggt gggatgtagc        60
     aacactgggt ggcgtaaaaa tgaaattatt gctattccac tacaacccac attgcaacaa       120
     gaggttattc tggctcgtat ggaacaaatc cttgcaagcc ggtcactgac agaagatgag       180
     tacgcacagc ttttatatga gcgcggtgtg ctgtatgata gcctcgggct gagggcactg       240
     gcacagaatg atttttcagt agctttgtct atccgccctg atattcctga aatttttaat       300
     tatctgggaa tttattttac gcaggcaggt aattttgatt ctgcctatga agcgtttgat       360
     tctgttttag agcttgatcc aacttacaac tacgcgcgaa tgaatcgcgg catcgcactg       420
     tattacggtg gccgttatcg attggcgcag gatgatctgc aggcgtttta tcaagacgat       480
     ccaaatgatc ctttccgttc gttgtggttg taccttgtgg aagcgaaaat cgatcctaag       540
     gttgcaatga ctaatttgtc gcaccatttt gacaaagcga accgggggct atggggctgg       600
     aatattgctg aattctattt gggcaaaatc agtgagaaaa tactgatgga gcgtttacaa       660
     cagaattcgg cggataacac ttcgctcgct gagcatctca gtgaaactga cttctattta       720
     ggtaaacatt acctaagtct gggggatgag gatagcgcag ttgcgttatt caagctgacg       780
     gtagctaaca atgtccatta ctttgttgag caccgctacg cattgttgga attggcgtta       840
     ttaagccaaa gacaagatga tttatcggaa tcgaaccaac aatag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page