(data stored in ACNUC1104 zone)

EMBL: FN667742.NRDG

FN667742.NRDG        Location/Qualifiers
FT   CDS_pept        complement(454767..455231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0098"
FT                   /gene="nrdG"
FT                   /locus_tag="XNC1_0520"
FT                   /product="anaerobic ribonucleotide reductase activating
FT                   protein"
FT                   /EC_number="1.97.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88594"
FT                   /db_xref="GOA:D3VIP4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88594.1"
FT                   /translation="MNYHQYYSVDAVNGPGTRCTLFVSGCLHQCRGCYNQSTWRSDSGL
FT                   PFTQATEDQIIADLKDHKIKRQGLSLSGGDPLHPQNVPAILQLVKRVRKECPDQDIWLW
FT                   TGYVLNELSEIQCEVINDINVLVDGKFEQALYDPTLIWRGSHNQIIHYLR"
     atgaattatc atcaatatta ttcggttgat gctgtgaatg gcccaggaac ccgctgcaca        60
     ctctttgtat cagggtgtct gcatcaatgc cgtggttgct acaaccaaag tacgtggcgg       120
     tcagattcag gtctgccgtt tactcaagcc acggaagatc aaatcatcgc tgacttgaaa       180
     gaccacaaaa ttaaacggca aggcttatca ttatccggcg gagatcccct gcatccgcaa       240
     aatgtaccgg ccatactgca actggtgaaa cgtgtaagaa aggagtgtcc tgatcaagat       300
     atttggttat ggacaggcta tgtccttaat gaattaagcg agattcaatg cgaagtgatc       360
     aacgatatca atgtattggt ggatgggaaa ttcgaacagg cgttgtacga ccccacattg       420
     atttggcggg gcagtcataa ccagataatc cactacttac gataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page