(data stored in ACNUC1104 zone)

EMBL: FN667742.OBGE

FN667742.OBGE        Location/Qualifiers
FT   CDS_pept        423181..424347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0091"
FT                   /gene="obgE"
FT                   /locus_tag="XNC1_0493"
FT                   /product="putative GTP-binding protein with nucleoside triP
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88567"
FT                   /db_xref="GOA:D3VIL7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88567.1"
FT                   /translation="MKFVDEARILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDITIKVPVGTRVRDIGTGEV
FT                   LGDMLRHEQRFMVAKGGFHGLGNTRFKSSVNRAPRQRTMGTPGESRELMLELMLLADVG
FT                   MLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEQSFVVADIPGLIEGAS
FT                   EGAGLGIRFLKHLERCRVLLHLIDLCPIDESNPVENARIIIRELYKYSEKLAEKPRWLV
FT                   FNKVDLIDSEEAKQRAKAIADELGWEGDYYMISAVNRQGVKELCWDIMEFMKTQPRSME
FT                   MSEEAQPEKVEFMWDDYHKEQLEQSSEDDFDDDWDEDDDEGIEFIYKR"
     atgaaatttg tagatgaagc caggattctg gttgtagcgg gagatggtgg caatggttgt        60
     gtcagcttcc gccgtgaaaa atatatccca aaaggtgggc ctgacggtgg tgatggcggc       120
     gatggtggtg acgtctatct gctggcagat gaaaacctca atacattgat tgattaccgt       180
     tttgaaaagt ccttccgcgc tgaacgtggt cagaatggac aaagccgtga ttgtaccggc       240
     aaacggggtc aggatatcac catcaaggtt ccggtcggaa cccgtgtgcg tgacatcggc       300
     acaggggaag tgcttgggga tatgctacgt catgaacagc gctttatggt agcaaaaggg       360
     ggcttccacg gcctcggtaa cacccgtttt aaatcctctg taaaccgggc tccccgtcaa       420
     agaacaatgg gtacgccggg ggaaagccgc gagctgatgc tggaactgat gttgctggca       480
     gatgtgggta tgctgggaat gccaaatgca ggtaaatcca cctttatccg tgctgtttca       540
     gcagcaaaac ccaaagttgc tgattatcca tttacaacat tagtgccaag cctgggtgtg       600
     gtgcgtatgg ataatgagca gagctttgtg gttgctgata ttccggggtt gattgaaggt       660
     gcgtcagaag gtgccggtct ggggattcgt ttcctgaaac acttggaacg ttgccgtgta       720
     ttgctgcact tgattgacct ctgcccgatt gatgagtcta atccggttga gaatgcccgc       780
     atcattatca gagagctgta taagtacagt gaaaaactgg cagagaaacc acgttggttg       840
     gtcttcaaca aagttgatct gattgactct gaagaagcta aacagcgtgc taaagcgatt       900
     gctgatgagc tgggttggga aggtgattat tacatgattt ctgcggtgaa ccgtcaaggc       960
     gtgaaagagc tttgctggga catcatggag ttcatgaaaa cacagcctcg tagcatggaa      1020
     atgtcggaag aagctcaacc tgaaaaagtt gaatttatgt gggacgatta ccataaggaa      1080
     cagttggagc agtcgtctga ggatgatttc gatgacgact gggacgaaga cgacgacgaa      1140
     ggcattgagt ttatttataa acgctaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page