(data stored in ACNUC1104 zone)

EMBL: FN667742.PE10

FN667742.PE10        Location/Qualifiers
FT   CDS_pept        complement(9396..9569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88103"
FT                   /db_xref="GOA:D3VG13"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88103.1"
FT                   /translation="MLYYNNIARGFMKSGIHPYYRTVVFHDTSTGSYFKVGSTIHTENH
FT                   YVGRERVPLYHD"
     atgttatatt ataacaatat agcgagaggg tttatgaaat cgggtattca tccctattat        60
     cgaactgtcg tgttccatga caccagtacg ggtagctatt tcaaggttgg ttcaacgatt       120
     catactgaga accattacgt tggaagggaa cgagtacccc tatatcacga ttga             174
//

If you have problems or comments...

PBIL Back to PBIL home page