(data stored in ACNUC1104 zone)

EMBL: FN667742.PE102

FN667742.PE102       Location/Qualifiers
FT   CDS_pept        complement(102607..103050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88195"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88195.1"
FT                   /translation="MIGAYYHPSRSLNNIHQDAPYTDKPIPHYTHNGTGYHVTLPMIPS
FT                   LRPGVVVNQQRLSKVNLTNENMTLTWIPKGQQEIVAPVVWVGSQQINVMTLMLDTLDVV
FT                   KELAELTAAHTHHNTDTPENASAIRNTAHKSDGLKQKYSPVIG"
     atgattggtg cgtattacca tccaagtaga tcactcaata acattcatca agatgcacct        60
     tataccgata aaccgattcc gcactacacc cataatggca cgggctatca cgtgaccctg       120
     cccatgatcc catctttgcg ccccggcgtg gtagtcaatc agcagcggct gagcaaggtc       180
     aacctgacca atgaaaacat gaccctcaca tggataccga aaggccagca agaaatcgtt       240
     gcccccgtgg tctgggtggg cagccagcaa atcaacgtga tgaccctgat gttagacacg       300
     ctggatgtcg tcaaagaact ggccgaactg accgccgcgc atacccatca caataccgac       360
     accccggaga acgccagcgc gatacgcaac acggcgcata aatcggatgg gctgaaacag       420
     aagtattcgc ctgtgattgg ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page