(data stored in ACNUC1104 zone)

EMBL: FN667742.PE106

FN667742.PE106       Location/Qualifiers
FT   CDS_pept        106515..107825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0021"
FT                   /locus_tag="XNC1_0111"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11554764; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88199"
FT                   /db_xref="GOA:D3VGA9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88199.1"
FT                   /translation="MSFLSELINKFDNKSASVAIVGLGYVGLPLMLRYSDIGFKVIGFD
FT                   IDQNKTDKLSQGLSYIEHISSSKIKKAIETGFEATTDFSRISECDAIILCVPTPLNKYR
FT                   EPDMSFVINTTDMVKPFLRQGQVLSLESTTYPGTTEEELLPRVEENDLTVGEDIFLVYS
FT                   PEREDPGNPDFETRTIPKVIGGHTENCLKAGIAVYQPAIDQVVPVSSTKAAEMTKLLEN
FT                   IHRAVNIGLVNEMKLVADKMGIDIHEVIRAAATKPFGFVPYYPGPGLGGHCIPIDPFYL
FT                   TWKAREYGINTRFIELSGEVNSSMPDYVVTKTVLALNKINKSINGSRVLVLGISYKKNV
FT                   DDMRESPSVHIMEKLRELGALVEYSDPHVPVFPKMREHHFDLISQSLTSNNLNKFDCIV
FT                   LATDHDKFDYELIINNAKLIVDTRGKYSPNHNNVIKA"
     atgtcatttc tgagtgaatt aattaacaag tttgataata aaagtgcaag tgtagctatt        60
     gttggattag ggtatgtcgg attaccttta atgctgcgat acagtgatat tggttttaaa       120
     gttatcggtt ttgatataga tcaaaataaa acggataagt taagtcaagg tttaagctat       180
     atagagcata tatcctcttc taaaattaaa aaagctattg aaacaggctt tgaagcaaca       240
     actgactttt caagaatttc cgaatgtgat gcgattatcc tctgtgtacc aactccatta       300
     aataaataca gagaacctga tatgagtttc gtcataaata ctactgatat ggtgaaacca       360
     ttcttaagac agggtcaagt actttcctta gaaagtacaa cttatccagg aacaactgag       420
     gaagagctat taccaagagt agaggaaaat gatttaacag tcggtgaaga tatattcctc       480
     gtatattcac cggaacgaga agatccgggt aatccagatt ttgaaacgag aacaatccct       540
     aaagttattg gtggacatac agaaaactgc ttaaaagcag gtattgccgt ttatcaacca       600
     gctattgatc aagttgttcc agttagctcc acaaaagcag cagaaatgac taagctgctt       660
     gagaatatac atagggccgt taatataggt ctagttaatg aaatgaagct cgttgcagac       720
     aaaatgggca ttgatataca tgaagtcatt agagctgctg caacaaaacc atttggattc       780
     gtcccttatt acccaggtcc aggtctaggt ggtcattgta tacctatcga tcctttctat       840
     ttaacatgga aagccagaga atacggtata aatactcgct ttatcgaact ttctggtgaa       900
     gttaattcgt caatgcctga ttatgttgtt actaaaacgg tcttggcatt gaataaaatt       960
     aataaatcca ttaatggcag tcgtgtactt gtattaggaa tttcatacaa gaaaaatgtt      1020
     gatgacatga gggagagtcc atcagtccat ataatggaaa aactaaggga attaggtgcg      1080
     ctagtagaat attcagaccc tcacgttcct gtttttccta aaatgcgcga acatcacttc      1140
     gatctaataa gccaatcatt aacttccaat aatttaaata aattcgattg catagtttta      1200
     gcaacagacc acgataaatt tgactatgag ttaattataa ataacgcaaa attaattgtt      1260
     gatactcgtg ggaaatattc tcctaatcat aataatgtaa taaaagctta a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page