(data stored in ACNUC1104 zone)

EMBL: FN667742.PE110

FN667742.PE110       Location/Qualifiers
FT   CDS_pept        111567..111773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /locus_tag="XNC1_0115"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88203"
FT                   /db_xref="GOA:D3VGB3"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88203.1"
FT                   /translation="MIFNKLTNSSKIFSAFIILIYVVVSYKHGLSVNNNMINLYLPYKN
FT                   YFIGDTQAYKNVDELKKIIEGIK"
     atgatcttta acaaattgac taatagctca aaaattttta gcgcttttat aatattaata        60
     tatgtagtcg taagttataa gcatggttta tctgtaaata ataacatgat aaatttatac       120
     ttgccttata aaaattattt cataggtgat actcaagcct ataaaaatgt cgatgaatta       180
     aaaaaaatca ttgaaggaat aaagtaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page