(data stored in ACNUC1104 zone)

EMBL: FN667742.PE113

FN667742.PE113       Location/Qualifiers
FT   CDS_pept        113932..115014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /locus_tag="XNC1_0118"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88206"
FT                   /db_xref="GOA:D3VGB6"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88206.1"
FT                   /translation="MKNFLYTYGSFFIAKAISVSVYSSALALWIPEKIINSQFQYLILI
FT                   EFFYGMLLFPLKISIIKNKEDIYTYLLWSFVFVILGYIYSFINFDTNLNLFVLLIGISL
FT                   FPIRLILTVHGEITNIDNFILKENLSSISSSIICAILFFTGDMTNAKFLLNIIYRELLT
FT                   TVFIIIFNANFISTAFKIKKTKFKWRETNILAGIDYLFALFLFKNILFKVISNGYYMSS
FT                   EFSDKTIKFFSILYDPMAAIFGIALRRNLAIKGYAEYLKNTKYFFIILAIINTGFYFLV
FT                   INISEFYFLATVFLFVFLAALLNSILLISTYIRYIIISLLCSITLSLHLDILPSFDLIF
FT                   FLPIFIFVFIYKFNLVKKRL"
     gtgaaaaatt tcttatatac ctatggaagc ttttttattg caaaagcaat aagtgtttct        60
     gtctacagtt ctgcacttgc tctttggata cctgaaaaaa taattaattc gcaatttcaa       120
     tatttgatat tgattgagtt tttttatggt atgctcctat ttcctctgaa aatttctata       180
     ataaagaaca aagaagatat atatacatac ttattatggt cttttgtttt tgttatatta       240
     ggatacattt attcctttat taattttgat acaaatttaa acttgtttgt tttgttaatt       300
     ggaatttcgt tattccctat tcgactgata ttaactgtcc acggcgaaat aacaaatata       360
     gacaatttta tcttaaaaga aaatttatct tcaataagta gttcaattat atgtgcaatc       420
     ttatttttca caggtgatat gacaaatgcg aaatttctcc taaatataat atatagagag       480
     ttattgacca ctgtatttat tataattttt aatgcgaatt ttatatcgac agcatttaaa       540
     ataaagaaaa caaaatttaa atggagagaa actaacatct tagctggaat tgattattta       600
     tttgcattat ttttattcaa aaatatactt ttcaaagtga tttccaatgg ttattatatg       660
     tcttctgagt tttcagataa aacaattaaa tttttttcta tactatatga cccaatggcc       720
     gcaatttttg gaatagcatt acgccgaaat ttggcaataa aaggctatgc ggaatattta       780
     aaaaatacaa agtatttctt tatcatctta gctataataa atactgggtt ttatttttta       840
     gttatcaata tatctgagtt ttatttttta gctacagtgt ttttatttgt ttttttagca       900
     gccttactta acagtatttt gttaatatca acatatataa gatatattat tatttcttta       960
     ctatgctcaa taactctatc tttacattta gatatattac catcatttga tttaatattt      1020
     ttcttgccta tatttatttt tgtttttatc tataaattta atctcgtcaa aaaaagacta      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page