(data stored in ACNUC1104 zone)

EMBL: FN667742.PE125

FN667742.PE125       Location/Qualifiers
FT   CDS_pept        119702..119896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0130"
FT                   /product="Insertion element IS1 1/5/6 protein insB
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88218"
FT                   /db_xref="GOA:D3VGC8"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88218.1"
FT                   /translation="MGRSTHQQWSFVGDKKNQRWFWYTWKLRLKRIVAYVFGDRSRKTL
FT                   DKLLTLLSPFNIRFYCTDD"
     ctgggtaggt ctactcacca gcaatggtca tttgtgggag acaagaaaaa tcaacgctgg        60
     ttttggtata cttggaaact tcgtctgaaa cgaatagtgg cttatgtttt tggtgatcgc       120
     agcaggaaaa cgttagataa actgcttacc ctcttatcac cctttaatat tcggttttac       180
     tgtacggatg actaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page