(data stored in ACNUC1104 zone)

EMBL: FN667742.PE129

FN667742.PE129       Location/Qualifiers
FT   CDS_pept        122814..124049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0134"
FT                   /product="putative glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88222"
FT                   /db_xref="GOA:D3VGD2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88222.1"
FT                   /translation="MNILYINHYAGSPYHGMEFRPYYLAKEWLNNGHKITILASSFSHV
FT                   RSKQPNIKHKITEENIDGIHYIWYPTNKYKGNGILRVINIFSFLLQIILFNKKIIKKTK
FT                   PNIILASSTYPLDIWVAKYLAKKHKAKLIFEIHDLWPLSPIELGGMSPKHPFMTLCQYA
FT                   ENSAYKYSDAVISILPKVHQHVIKHGLDINKLHIIPNGIVYSDWEDGNYDKIPDNIRSK
FT                   INTLKNKGYTIVGYSGSHGIPNALRYLIEAADLLRDKPFHFILVGSGLEKNNLLEYKNS
FT                   LDLENITFFEPITKKQMPDLLTLFDISYIGAHKTPIYRFGISPNKLMDYMMAENVILSS
FT                   IEAGNDPVTDAACGITVEAESSKAIADALIKLSEYSLEEKQQMGKNGKNYVLKNHTYSV
FT                   LADKFLQVMKKL"
     atgaacatat tatatattaa tcattatgct ggaagtcctt atcatgggat ggaatttagg        60
     ccgtactatt tagcaaaaga gtggttaaat aacggacaca aaataaccat attagcatct       120
     tcattctctc atgtacgatc aaagcaaccc aatataaaac acaagataac agaagaaaat       180
     attgatggca tacattatat ttggtatcca actaataaat ataaaggaaa cggaatactt       240
     cgtgtaatca atatattttc tttcttattg caaattattc tgtttaataa aaaaatcatt       300
     aaaaaaacaa aaccaaatat aatactagct tctagtacat atcctctaga catctgggtt       360
     gcaaaatatc tagctaaaaa acataaagca aaactaatat ttgaaatcca tgacctgtgg       420
     cctttatctc ctatagaact aggtggaatg tctccaaagc atccatttat gacgttgtgt       480
     caatatgctg agaatagtgc atataaatat tcagatgctg tgatatctat attgcctaaa       540
     gttcatcaac atgtcattaa gcatgggcta gatataaata aattacatat tattcctaat       600
     ggaattgtat attctgattg ggaagatggt aactatgata aaataccaga taatattaga       660
     tcaaaaataa atacattgaa aaataaaggt tatacaatag ttggctattc tggctctcat       720
     ggcataccta atgcattacg ctacttaata gaagcggctg acttattaag agataaacca       780
     ttccatttta ttctggttgg ttctggatta gagaaaaata atcttttaga atataagaac       840
     tcactcgatt tagaaaatat cactttcttt gaaccgataa ctaaaaaaca gatgccagat       900
     ctactaacat tatttgatat tagctatata ggcgctcata aaacacctat ttatcgtttt       960
     ggtatatctc ccaataaatt aatggattat atgatggctg aaaatgttat tttaagctct      1020
     attgaagccg gaaatgatcc cgttacagat gctgcttgtg gaataactgt ggaagcagaa      1080
     tcatctaaag ctattgctga tgccttaatt aaattaagtg agtactcttt ggaagaaaaa      1140
     caacaaatgg gtaaaaatgg taaaaattat gttctaaaga atcatactta ctccgtgtta      1200
     gctgataaat ttttacaagt gatgaaaaaa ctatga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page