(data stored in ACNUC1104 zone)

EMBL: FN667742.PE138

FN667742.PE138       Location/Qualifiers
FT   CDS_pept        complement(130761..131198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0025"
FT                   /locus_tag="XNC1_0143"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88231"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88231.1"
FT                   /translation="MLQEIMQFISRNTILSLVWIALLVAVIVMTAKSAFSKCKEITRAQ
FT                   AIHLINKEDAVVVDLRSRDDFRKGHIIGSVNLIPSEIKDNNLGELEKHKKQPVIVVSAN
FT                   GMEARTPAENLVRFGFEQVYSLKEGVAGWSGENLPLARGKK"
     atgctgcaag aaatcatgca atttattagc cggaacacga tcctgagcct tgtctggatt        60
     gcattgctgg tggctgttat cgtcatgaca gcaaaaagcg cgttctccaa gtgtaaagag       120
     atcacccgcg cacaagctat tcatttgatc aataaggaag atgctgtcgt cgtggattta       180
     cgctcccgtg acgatttccg caaagggcat attattggtt ccgttaacct catcccatca       240
     gagattaaag acaataatct gggtgagtta gaaaaacata aaaaacaacc tgtgattgtc       300
     gtttcagcga atggaatgga agccagaaca cccgcagaga atctggtgcg ttttggtttt       360
     gagcaggttt attccctgaa agagggagtt gccgggtggt ctggtgaaaa tctgccattg       420
     gcccggggca agaagtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page