(data stored in ACNUC1104 zone)

EMBL: FN667742.PE140

FN667742.PE140       Location/Qualifiers
FT   CDS_pept        131754..132095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0026"
FT                   /locus_tag="XNC1_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88233"
FT                   /db_xref="GOA:D3VGU8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88233.1"
FT                   /translation="MSEGLFEGVIMAKARLHDDAMVQLLREDPEFAQYYLHQAFVDMDE
FT                   EGGQEAFLMALRHVVEARGGMAQIADKAGVSRETLYRTLSPKGNPTLKTLRNIIAATGF
FT                   PLSHLAAMI"
     atgtctgaag gactatttga aggggtgatt atggctaaag cacgtttaca cgatgatgca        60
     atggtgcagc ttctccgtga agatcctgag tttgcacagt attatctgca tcaggcgttt       120
     gttgatatgg atgaagaagg cggacaggaa gcattcctta tggcattgcg ccatgttgta       180
     gaagcgcggg gaggcatggc gcagattgca gataaagcgg gcgtttcacg tgagacacta       240
     tatcggacac tgtcgcctaa gggcaatccg acgctgaaaa ctttgcgcaa tatcattgca       300
     gcaacaggat tcccgttatc tcatcttgct gcaatgattt aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page