(data stored in ACNUC1104 zone)

EMBL: FN667742.PE142

FN667742.PE142       Location/Qualifiers
FT   CDS_pept        133687..134736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0027"
FT                   /locus_tag="XNC1_0147"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88235"
FT                   /db_xref="GOA:D3VGV0"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88235.1"
FT                   /translation="MMKMKYLLIKHVGLFTLLFWILSFFTSVSFTLNARAARLAIVIDD
FT                   VGYRIHEENKILQMPIAVSVAILPDSPHGREMAVKAYQQGREVLIHLPMAPLSQQPLEK
FT                   NTLHPAMSREEIGRIIQEAIQKVPHAVGMNNHMGSAMTSDLTGMEKVMQVLSRHHLYFL
FT                   DSVTIGNTQVTKAATGTSVPVIRRNIFLDNVQTEAETRHQFNRAITLARKKGSAIAIGH
FT                   PHPTTVRALQQALATLPDDIELVTPGILLGHEPSNKREQQITRQCTKPRQSEPVPETQL
FT                   DYLKEIGKALANNIIVNTLSQHFQKLLQSVPKQEAPNTLNKTIGGQVTVNQDAGKKKSH
FT                   QKEDQTRCP"
     atgatgaaaa tgaagtatct attaataaag catgttggct tgttcactct gttattttgg        60
     atactttcat ttttcacatc agtatcgttt accttaaatg cccgggctgc acgattagcg       120
     attgtcattg atgatgttgg ctatcgtatc catgaagaaa acaagatatt gcaaatgccc       180
     attgcagttt ctgtcgccat tcttcccgat tccccacatg gcagagaaat ggcggtaaag       240
     gcttatcagc agggaagaga agtgttgatc catctgccga tggcaccatt aagtcaacaa       300
     cctttagaaa aaaatacgct gcatcctgct atgagccggg aagaaattgg ccgtattatt       360
     caagaggcaa tacaaaaagt gcctcacgcg gttggcatga ataaccatat gggcagcgcg       420
     atgacctctg atctcactgg aatggaaaag gtgatgcagg tgttgtcccg gcatcatctg       480
     tattttctgg atagtgtgac gattggcaat acgcaagtga cgaaagcagc gacaggaacc       540
     tctgttcctg tgatacgccg gaatattttt ttagataatg ttcagacgga agcagaaaca       600
     cgacatcagt ttaaccgggc gattacgctg gcacgtaaga aaggttctgc cattgcaatt       660
     gggcatccac acccaaccac ggttcgtgct ttacagcaag ctcttgcgac attacccgat       720
     gatattgaat tagtcacacc gggcatatta ctgggccatg agccgtcaaa taaacgtgaa       780
     cagcagataa ctcgtcagtg tacaaaaccc cggcaatctg aacctgtacc ggaaacccaa       840
     ctggattatc tcaaggagat tggaaaggca ttagcgaata atattattgt gaatacgtta       900
     agtcagcatt ttcagaaact tttgcagagt gtaccgaaac aagaggcacc aaatacgtta       960
     aacaaaacaa taggaggcca ggtgacagtg aatcaggatg caggcaagaa aaaatcacat      1020
     caaaaagagg atcaaacaag gtgtccataa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page