(data stored in ACNUC1104 zone)

EMBL: FN667742.PE148

FN667742.PE148       Location/Qualifiers
FT   CDS_pept        140407..141192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88241"
FT                   /db_xref="GOA:D3VGV6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88241.1"
FT                   /translation="MIFSDKSDVTIVITSCGRFELLENTIQSLDKHNTYPIGKVIITED
FT                   SGNKKIVEVIPEHWKPHCKIIINNPKLGQIKSIDLAYSKVETQYIFHCEDDWLFYRDGF
FT                   IEDSRLLLEENHDILQVWLRDFEKDIKINYPFHYPSNPQSVCGVDFSILESNDEVWKGF
FT                   SFNPGLRRKSDYLRIAPYYVGKDFGEAEAHISKLYYDMGMYAVLLKNSATEHIGWDQHI
FT                   INENDIFHNKDKIQKKIKYFSIGFLFGCILTFVFISLMK"
     atgatttttt cagataaaag tgatgtcact atagttatca caagttgtgg aaggtttgaa        60
     ctattagaaa atactattca atcattggat aagcataata cttatccaat tggaaaagtg       120
     ataattacag aggattcagg aaacaaaaaa attgtagagg taataccaga acattggaaa       180
     cctcattgca aaataataat aaataatccc aagcttgggc aaataaagtc tatagatcta       240
     gcttatagta aagtagagac acaatatatt ttccattgtg aagatgattg gctcttttat       300
     agagatggat ttatcgaaga ttcacgttta ctgcttgaag aaaatcatga cattctgcaa       360
     gtatggttac gtgattttga aaaagatatc aagattaatt accctttcca ttatccctct       420
     aatccgcaat cggtctgtgg agtagatttt tcgatattag aaagtaatga tgaagtttgg       480
     aaggggttta gctttaatcc tggtttacgc agaaaaagcg attacttaag aatagcgcct       540
     tactatgttg ggaaagattt tggagaagct gaagcacaca tttcaaaatt gtattatgac       600
     atgggaatgt atgctgttct cttaaagaat agtgcaacag aacatattgg ctgggatcag       660
     catattatta atgaaaatga tatttttcat aataaagaca aaatacaaaa gaaaataaaa       720
     tatttctcaa taggatttct ttttggctgt atcttaactt ttgtttttat ttctttgatg       780
     aaataa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page