(data stored in ACNUC1104 zone)

EMBL: FN667742.PE150

FN667742.PE150       Location/Qualifiers
FT   CDS_pept        complement(143012..143971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0155"
FT                   /product="putative WbfO protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88243"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88243.1"
FT                   /translation="MNLSPRLSVLMSVYNGEDYLAESIDSILSQTFGGYELIIIDDGST
FT                   DSTSSILSSYAKKDTRIRVITNENNIGLIRSLNKGLHIASSNLVARMDADDIAIPERFE
FT                   IQMDFMRDHPNVAVCGGFTTYLENPAKGDVHAINHEDIVAECFFHCPFAHPTVIMRKDK
FT                   ILELTDGYDPNDLYAEDYGLWSRLVISKKIKFANIDKSLLKYRTHPNNPRIEYKKKQKE
FT                   TANDIQRKMFLSLGINIPLKDIDLLNHSEGKISIGNIKKCESWLLKIERSTDNMEPLER
FT                   IAFLKEIKDKKMYLWRRIRKNSIPAILRYITARFYYRK"
     atgaacttat cccctagact ttctgtatta atgtcagtct acaatggcga agactattta        60
     gcagaatcta ttgattctat attatcacag acatttggag gttatgagct tataataatt       120
     gatgatggct caactgattc gacctcttct attctatctt catatgccaa aaaagatacg       180
     cgaattagag tcataaccaa tgaaaacaat attggtttaa ttcgttctct taataaggga       240
     ttgcatatag catctagtaa tttagttgca agaatggatg ctgatgatat tgcaattcct       300
     gagcgctttg aaattcaaat ggattttatg cgtgatcacc caaatgtagc tgtttgtgga       360
     ggattcacaa catatctgga gaacccagct aagggtgatg tgcatgctat aaaccatgaa       420
     gatattgttg ctgaatgttt ttttcattgt cccttcgctc atcctactgt gattatgagg       480
     aaagacaaaa tattagagtt aacagatgga tatgatccaa atgacctata tgcggaagat       540
     tacggactat ggagccgatt agttatttcg aaaaagatta aatttgcaaa tatagataaa       600
     tctcttttaa aatatcgtac acatccaaat aatcctagga ttgaatacaa gaaaaagcaa       660
     aaagaaacag caaatgatat tcagagaaaa atgttcttat ctttaggtat aaacattccg       720
     ttgaaagata ttgatttact caatcattct gaaggtaaaa tatctattgg caacatcaaa       780
     aaatgtgaat cttggctgct aaaaatagaa agaagcactg ataacatgga accccttgaa       840
     agaattgctt ttttaaagga aattaaagat aaaaaaatgt atttatggag aagaatcaga       900
     aaaaattcaa ttccagcgat actaagatat ataactgcaa gattttacta tagaaaataa       960
//

If you have problems or comments...

PBIL Back to PBIL home page