(data stored in ACNUC1104 zone)

EMBL: FN667742.PE154

FN667742.PE154       Location/Qualifiers
FT   CDS_pept        complement(147449..148579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0030"
FT                   /locus_tag="XNC1_0159"
FT                   /product="Lipopolysaccharide core biosynthesis protein RfaG
FT                   (Glucosyltransferase I)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88247"
FT                   /db_xref="GOA:D3VGW2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88247.1"
FT                   /translation="MKSIRLAIVRQKYRPDGGAERFISRALEALDNDSLDLNVITRSWQ
FT                   GDINPNWHVHLAAPFKWGRISREKRFADAAKAIWQKEHFDIVQSHERIAGCDIYRAGDG
FT                   VHQRWLQQRSRILPAWKSKLLFTSRYHRYVMNAEEEMYLAPELKKVICNSQMIKREVME
FT                   NFGLPDEKISVIYNAIDQSEFFPAGEDERLVLRQKYALPAQAKCFVYVGSGFERKGLKA
FT                   AIEAIGMTKDYLVVIGQDKEENKYKQLAHSLGCHDRIRFLGVQKETLPFYQMADGLLLP
FT                   TLYDPFPNVVLEAMACGLPVITSHTCGGSEFITSGENGFVCDALDISGLAESISSVPAD
FT                   HLTSRFSMLSKEKIVNYTPAYLSQQLTELYNKVLSL"
     atgaaatcga tacgccttgc cattgtccgg caaaaatacc gccctgatgg aggggctgag        60
     cgttttatct ctagggcact cgaagcatta gataatgaca gcctggattt aaatgtgatt       120
     actcgctcgt ggcaaggaga tataaaccct aactggcatg tacatttggc agcgcctttt       180
     aaatggggac gcattagccg ggaaaaaaga ttcgccgatg cagccaaagc catttggcaa       240
     aaagagcact ttgatattgt gcaaagccat gaacgcattg ccggatgcga tatttaccgg       300
     gcaggagatg gtgtccatca acgctggtta cagcaaagat cacggatttt acccgcctgg       360
     aaaagcaaat tgctctttac cagtcgttat catcgttatg ttatgaatgc tgaagaagaa       420
     atgtatctgg cacctgaatt gaaaaaagtt atttgcaatt cacagatgat aaaacgcgag       480
     gtaatggaaa attttggttt acctgatgaa aaaatctccg ttatctataa tgctattgat       540
     cagtcagaat tttttccagc cggagaagat gagcggcttg tattaaggca gaaatatgcg       600
     cttcccgccc aagcaaaatg ttttgtgtat gttggttcag gttttgagcg aaaaggatta       660
     aaagcagcca ttgaagcaat cggcatgaca aaagattatc tggttgtcat tggtcaagac       720
     aaagaagaaa ataaatataa acagttggct cattcgcttg gatgtcatga ccgaattcga       780
     tttctgggag ttcagaaaga gacgcttccc ttttatcaaa tggcagacgg actattatta       840
     ccgacattat atgatccttt tcctaacgtt gtattagaag caatggcatg tggcttaccc       900
     gttataacga gtcatacatg cggaggatct gagttcatta catcgggtga aaatggtttt       960
     gtatgtgatg ccttagatat ttcaggcttg gcagaatcta tctcttcagt gccagcagat      1020
     catttaacca gtcgattttc aatgttatca aaagaaaaaa tagtaaacta cacacctgct      1080
     tatttgtctc agcagcttac ggaactgtat aacaaggtac tttcgctatg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page