(data stored in ACNUC1104 zone)

EMBL: FN667742.PE156

FN667742.PE156       Location/Qualifiers
FT   CDS_pept        149584..149757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88249"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88249.1"
FT                   /translation="MMPEFYDENLFKSTSCFTHCVFNVRCLRKKNLITLYSKDRILPFL
FT                   SLDIKYIALKNE"
     atgatgcctg agttttatga tgagaatctt ttcaaatcga cgagttgttt tacccattgt        60
     gttttcaatg tccgctgtct gaggaaaaaa aatcttatta cattatattc taaagaccga       120
     atccttccct ttctatcttt ggatatcaag tatattgctt tgaaaaatga gtaa             174
//

If you have problems or comments...

PBIL Back to PBIL home page