(data stored in ACNUC1104 zone)

EMBL: FN667742.PE161

FN667742.PE161       Location/Qualifiers
FT   CDS_pept        153371..153823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0032"
FT                   /locus_tag="XNC1_0166"
FT                   /product="O-antigen ligase RfaL (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88254"
FT                   /db_xref="GOA:D3VGW9"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88254.1"
FT                   /translation="MLNVKNKFNLNNNKKSLWNLSIVGLYVILVYLPDITRYKNLVMIL
FT                   ICTTALYYLVKDFRQVTNALRSHLVLSVLLFVLAMFYSVGISIDPALSFKEMNKPILNG
FT                   LLLFSLTFPIVLYQESKEDIARMILVAFIIGMAAISLTDIAKYIIN"
     atgcttaatg taaaaaataa atttaactta aataataaca agaagtcctt atggaattta        60
     tccattgttg gactgtacgt tattcttgtt tatctgcctg atatcacaag atataaaaat       120
     ttggtcatga ttctgatctg tacaacggca ctgtattatc tggtaaaaga ctttcgccag       180
     gtaacaaacg cgttgcgtag tcatctggtg ttgtccgttt tactgtttgt tctggcaatg       240
     ttctattctg ttggaatctc tattgatccg gcattgagct tcaaggaaat gaacaaacct       300
     atcttaaatg ggttactgct gttcagtctt acttttccaa ttgtgcttta ccaggagagt       360
     aaagaagata tcgcgaggat gatcctcgtt gcatttatta tcggtatggc tgctatttcg       420
     ctgacagata ttgcgaagta cattattaat taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page