(data stored in ACNUC1104 zone)

EMBL: FN667742.PE163

FN667742.PE163       Location/Qualifiers
FT   CDS_pept        154816..155604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0032"
FT                   /locus_tag="XNC1_0168"
FT                   /product="O-antigen ligase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88256"
FT                   /db_xref="GOA:D3VGX1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88256.1"
FT                   /translation="MGEMPFSNFNHREFSYGFIFYFPVLLCTWALWKKHALLSWLLLII
FT                   ASAISLFLLLGTLARGAWVAILVATVFIIAINREWKLTVAAAICLGLLAGVTHWSAGSN
FT                   PDTRLLIHKLTQTDSSHRYSNGTQGSAWSLIMENPVKGYGFGNKVYHQVYNSRVADYPD
FT                   WTYRTSIGPHNIFLSLWFSAGILGLVTTLLMTFSVLLTGSRIIRQHSGIIRQSGIILLA
FT                   AFIGVFIVRGAFENAYINEIGILLGLLIALYKKTTSKAIN"
     atgggtgaaa tgccattttc taattttaat caccgtgaat tttcctacgg gtttattttc        60
     tatttcccgg tattattatg cacttgggcg ttatggaaaa aacacgcttt actgagttgg       120
     ttactgttga ttattgcttc ggctattagc ttgttcttac tgctcggtac gcttgctcgc       180
     ggtgcctggg ttgccatttt ggtcgccact gtatttatca ttgcaattaa ccgagagtgg       240
     aaactcacgg ttgcggctgc aatatgtctg ggattattag ctggcgtaac acattggtcg       300
     gcagggtcga acccggatac gcgattattg attcataaac tcactcaaac agacagtagt       360
     catcgctata gcaatggtac tcagggttcc gcatggtctc tgattatgga aaatcccgtt       420
     aaaggatatg gttttggtaa taaagtttat catcaagtct ataatagccg tgtggccgat       480
     tatcctgact ggacatacag aacgtcaatt ggtccacata atatcttttt atcactttgg       540
     ttttcagcgg gtattctcgg tctggtcacc acactcttga tgacattttc agtattactg       600
     actgggagcc ggatcattcg ccaacatagt ggcattatcc gacagtcagg aattatactc       660
     ctggccgctt ttattggcgt atttattgtc agaggtgctt ttgaaaatgc ctatattaat       720
     gagataggta ttttattggg tttattgatt gctttgtata agaaaacaac cagtaaggca       780
     ataaactaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page