(data stored in ACNUC1104 zone)

EMBL: FN667742.PE164

FN667742.PE164       Location/Qualifiers
FT   CDS_pept        complement(155680..156858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0033"
FT                   /locus_tag="XNC1_0169"
FT                   /product="WalM protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88257"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88257.1"
FT                   /translation="MKIAYIDPYPVPDYRVASLQILQNVDAFARQGHHVCLITPKGQSQ
FT                   AEEIMGRSLPPSAEQITLHDIRRKWYFPLNTQKLFYFQVSRWLKEHPVDAIFTRNIKMA
FT                   NYLLCKHPEIPHFFESHEVFSQSFKESHDLVKHKNQHKYQKLRKIEQQVYERSQVVFVL
FT                   TSLLGEDIYKEYGVKTPIVIAPDGVDMLAVNATNLTPSGKEYKDGLPTQVLYLGSLHRW
FT                   KGIPTVMKAMSFLDNAMLNIAGGTPEQITRLRQTAKQIGVADRVNFLGFVQPKHRFQVI
FT                   ADHDICVLPLTKTSIGSRYTSPLKLFEYMAMGKPVVISDFPSIRDAVDEKAVNFANSEN
FT                   AESFAEQIQWLINHPAEVMKKVDYARQLVAERFNWDQRAKLITNVIAEKLSE"
     atgaaaatcg cgtatatcga tccttaccct gtccctgatt atcgagttgc ttcattgcag        60
     attctgcaaa atgttgatgc ttttgctcgc cagggacatc atgtttgcct gattacccca       120
     aaaggccaaa gccaagctga agagattatg ggcagatcac tgccaccttc tgcagagcag       180
     atcaccttgc acgatatccg tcggaagtgg tattttccgc taaatactca gaaattattt       240
     tattttcagg tttcccgctg gcttaaagaa catccggttg atgccatctt cacccgcaat       300
     ataaaaatgg caaattacct attgtgtaag catcctgaaa ttccgcattt ctttgaaagc       360
     catgaagtgt tttctcaatc atttaaagaa tctcatgatt tggtcaagca taaaaatcag       420
     cacaaatatc agaaattgag gaaaattgaa caacaggttt atgagcgctc gcaggtcgtt       480
     tttgttctga cttcgttgtt gggtgaagat atttataaag agtatggcgt taaaacaccg       540
     attgttattg ctcctgatgg cgttgatatg ctggccgtta acgctacaaa cttaacgcct       600
     tccggcaaag aatataagga cggattgcca acccaagtgc tttatttggg gagcctgcat       660
     cgttggaaag gcattccgac tgtgatgaaa gccatgtctt tccttgataa cgctatgttg       720
     aatattgcag gcggtacgcc tgaacagatc acacgattac ggcaaacagc caaacagatt       780
     ggtgtagctg acagagtcaa tttccttggc tttgtccaac ctaaacatcg ctttcaggtt       840
     atcgctgatc atgatatttg tgtcctgcca ctgacaaaaa ccagcattgg cagccgttat       900
     acttcccccc tcaaactttt tgaatatatg gccatgggta aaccggtcgt tatttcggat       960
     ttcccttcca tccgcgatgc tgttgatgag aaggcggtca attttgccaa tagtgaaaat      1020
     gccgaaagtt ttgccgaaca gatccaatgg ctgataaatc atccagccga agtgatgaaa      1080
     aaagtggatt atgcacggca attagttgcg gaacgtttta attgggatca aagggcaaaa      1140
     ttgattacaa acgtgatagc cgaaaaatta tctgaatag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page