(data stored in ACNUC1104 zone)

EMBL: FN667742.PE165

FN667742.PE165       Location/Qualifiers
FT   CDS_pept        complement(156858..157961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0033"
FT                   /locus_tag="XNC1_0170"
FT                   /product="WalN protein"
FT                   /EC_number="2.4.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88258"
FT                   /db_xref="GOA:D3VGX3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88258.1"
FT                   /translation="MKIGFIDVTVTMSYGGIQTAVWELAKALTDAGHEIHIFGGTGDIR
FT                   PELAGRNIHIHTFPFIPRERVLNIGRRFQRIVERYSFARHAREAVMAENFDWLILTKPF
FT                   DFFWPRMIPKTSHTKFCYMSGGTSFFKGDRILGKKISAWVACSHFNAWQIQHHFKQFPS
FT                   VIYNGVNTDKFKPIDSDIRTRLGINEDTFLLTFAGRLVGWKGMKVAIEAMTLLRDKDVK
FT                   LLIIGAGEELKQLEKRVSALKLKESVIFHPPVSHDQLPEFYAAGDAGLFPSIGDEAFGI
FT                   TIAEAMACGRPVIASYIGGIPEVVGNENQAGILVTPGDAPAIAASVNHLLSLEDRGKGM
FT                   GKCARQRIEAMYTWEHSANRLLNAIKK"
     atgaaaatag gatttatcga tgttaccgtt accatgtctt atggcggtat tcaaaccgcg        60
     gtttgggagt tggccaaggc attaacagat gcggggcatg aaatccatat tttcggtgga       120
     acaggtgata ttcggcctga attagctgga cgaaatattc acattcatac atttccgttt       180
     attcccagag aacgagtgct taatattggg cgccgttttc aacgtattgt tgaacgctac       240
     tcttttgccc gacatgcacg tgaagcggtg atggctgaaa attttgattg gcttatctta       300
     actaagccct ttgatttttt ctggcccaga atgattccta aaacatccca taccaagttt       360
     tgctacatga gcggaggaac cagctttttt aaaggggatc gaattttagg taaaaaaata       420
     tccgcatggg ttgcatgtag ccatttcaat gcctggcaga tccagcacca ctttaagcaa       480
     tttccaagtg tcatctataa tggggtgaat actgataaat tcaaacctat tgattcagat       540
     atccgcaccc gactgggtat caatgaagat acctttttgt tgacatttgc aggtagactg       600
     gtgggctgga aaggcatgaa agttgccatt gaggcgatga ctttactcag ggataaggat       660
     gtaaagctat tgattatcgg ggcaggagaa gaattaaagc agcttgaaaa acgggtttca       720
     gcattaaaac tcaaagaatc tgttattttt cacccgcctg tcagtcatga tcagttacct       780
     gagttttatg cagcaggtga tgctggtctc ttccccagca tcggcgatga ggcatttggc       840
     attacaattg cggaagcaat ggcgtgtgga cgcccggtca ttgccagcta tattggtgga       900
     atacctgaag tggttggcaa cgagaaccag gcaggtatcc tggtcacccc tggtgatgct       960
     ccagccattg ctgcttcagt caatcatctt ttatctttag aagatagagg gaaaggtatg      1020
     ggtaaatgtg ctcgtcagag gattgaagct atgtatactt gggaacattc tgcgaatcgc      1080
     ttactgaatg ccataaaaaa ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page