(data stored in ACNUC1104 zone)

EMBL: FN667742.PE167

FN667742.PE167       Location/Qualifiers
FT   CDS_pept        complement(159165..160283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0172"
FT                   /product="WalR protein"
FT                   /EC_number="2.4.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88260"
FT                   /db_xref="GOA:D3VGX5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88260.1"
FT                   /translation="MAKKTLNILHTESSCGWGGQEIRILTESQGMIQRGHHVVIVCCPT
FT                   STLYREAHHYGVPVVALPIEKKRLSCLRAMRRWLKTEGRQFDVINTHSSTDSWLAAAAC
FT                   AVLKGMPPIIRTRHVSTHVSKSMATRWLYLHACQHIVTTGGKLRQYLHTHNTYPLSHMT
FT                   SVPTGIDLTRFHPEDKLQSRQRIGIENKPTLGIVATMRTWKGHRYLLDSWKILHQHYPD
FT                   WQLLFVGDGPQRKNLEPHVQQAGLTGSVIFLGNRQDVPDCLNAMDIFALPSFGNEGVPQ
FT                   GIMQAMACGLPVVSTSVGAITEAVIDGDTGYIIEPKNAEQLTEKLDFLMKDAELRSQMG
FT                   NASLQRATHLFGMDNMLEKMESIFYRSINSKR"
     atggctaaaa agactttgaa tatcttacac acagaatcat cgtgtggctg gggagggcag        60
     gagattcgca tcctgactga atctcagggc atgatacagc gtggtcacca tgtggttatc       120
     gtttgctgtc caacctcaac actttaccgt gaagctcatc attatggtgt gcctgtcgtc       180
     gctctcccga ttgaaaaaaa acgcctttct tgcttacggg caatgcgtcg ttggctcaaa       240
     accgaaggcc gtcaatttga tgttattaat acgcacagtt ccacggactc ttggttggca       300
     gcagcagcat gtgcagtatt aaaagggatg cccccgataa tacgtacccg ccatgtctcc       360
     acccacgttt caaaatctat ggcgacccgt tggctctacc tgcatgcctg ccagcatata       420
     gtgacaaccg ggggaaaact gcgtcaatat ctgcataccc acaatacata cccactttcc       480
     catatgacct ctgtgcctac agggatcgat ttaacgcgtt ttcatcctga agacaaactt       540
     caaagccgcc agcgcattgg tatagaaaac aagccaacac tgggtattgt tgccacaatg       600
     agaacgtgga aaggccatcg ttacttgctt gatagctgga aaattcttca ccaacattac       660
     cctgattggc aattattgtt tgtgggagat ggcccccagc gaaaaaatct ggagccacac       720
     gttcaacagg cagggttaac aggaagcgtt atttttcttg gtaaccgtca ggatgttcct       780
     gattgcctga atgcgatgga tatctttgct cttccttcat ttggcaatga aggcgtacct       840
     cagggcatca tgcaggcaat ggcatgtggg ttacctgtcg tctccacatc cgtgggcgcg       900
     attaccgaag ctgtgattga cggggatacg ggatatatta ttgaacctaa aaatgcagaa       960
     caattaacag aaaaattaga ttttctgatg aaagatgcgg agttgcgttc acaaatgggg      1020
     aatgcctcat tacaacgagc cactcactta ttcggtatgg ataacatgtt agagaaaatg      1080
     gaatctattt tttatcgcag tataaacagc aagcgatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page