(data stored in ACNUC1104 zone)

EMBL: FN667742.PE17

FN667742.PE17        Location/Qualifiers
FT   CDS_pept        complement(15323..16057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /locus_tag="XNC1_0017"
FT                   /product="Zinc metalloprotease"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12125824; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88110"
FT                   /db_xref="GOA:D3VG20"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88110.1"
FT                   /translation="MAQLKIGEIDMQLNRKAIKNLHISVLPPDGIVRISAPMHMSDTAI
FT                   RMAVISRIPWIKKQQQDFARQPRQSEREMVNGECHYLWGRRHRLNIVEHVGKQQVKTSG
FT                   GKIYLYVPYGAPFEKKAQVLSDYYRAALKERIEKLLMHWQPIIGVMPSSWGIKKMKTKW
FT                   GSCNTVSGSIWLNLELAKKPLECLEFILVHELVHLLERKHNERFMTYMDGYLPDWRERK
FT                   RLLSILPLSNDVLVQTRSDTSV"
     atggcacagt tgaagattgg cgaaatagat atgcagctca atcgcaaagc gataaagaac        60
     ctgcatatca gtgtgttgcc tcctgatggg attgtacgga tttcagcacc gatgcatatg       120
     agtgataccg ccattcgaat ggcggttatc agccgtatcc cctggattaa aaaacagcag       180
     caggattttg cacgccaacc acgccaatca gaacgtgaga tggttaatgg cgaatgtcac       240
     tacctttggg gaagacgaca tcgtttaaac attgtggaac atgtcggtaa gcaacaagtt       300
     aagactagtg gaggaaagat ttatctttat gttccttatg gcgctccatt tgagaaaaaa       360
     gcacaggtac tttcagatta ttatcgagca gctttaaaag aacgaataga aaagctgtta       420
     atgcactggc aacccattat tggtgtgatg ccttcgtcat ggggcatcaa aaaaatgaaa       480
     accaaatggg gtagctgtaa tactgtttct ggcagtatct ggctaaactt agaattggca       540
     aaaaaaccac tggagtgtct ggaatttatt ttggttcatg aactagtgca tcttttagag       600
     cgcaaacata atgagcgatt tatgacttat atggacggct atttacctga ttggagagaa       660
     aggaaaaggt tgttaagcat tttgccacta tctaatgatg tattagttca gaccagatct       720
     gacacttcag tttga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page