(data stored in ACNUC1104 zone)

EMBL: FN667742.PE170

FN667742.PE170       Location/Qualifiers
FT   CDS_pept        160796..161095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88263"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88263.1"
FT                   /translation="MGAVVTTHRALAGNLADSGHVYISKNQISSSFVLGMAASSGLGAH
FT                   LSTFSLLKKRYGKDTHFLSKKLTEIGSSRQAQDPQRWRSIRPHSLMLKSRTTKI"
     gtgggagcgg ttgttaccac tcaccgggcg cttgccggta acttggcaga ctcgggacat        60
     gtctatatct ccaaaaatca aatcagctcg agctttgtat tgggtatggc cgcctcgtca       120
     ggcttaggag cccatctcag tacattttcg ttactgaaaa aacgttacgg aaaagacaca       180
     cacttcctca gtaaaaaact tactgagata ggctcttctc gccaagccca agatcctcaa       240
     aggtggcgta gtatacgccc tcattcgctg atgctcaagt cccgaacaac taagatctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page