(data stored in ACNUC1104 zone)

EMBL: FN667742.PE180

FN667742.PE180       Location/Qualifiers
FT   CDS_pept        169267..169509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0185"
FT                   /product="Putative cytoplasmic protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88273"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88273.1"
FT                   /translation="MAKQKNPRMKNTSPYPEVGNARKRHTADFLGISDSTLHRWVKDKK
FT                   IPQPFELEGGFFVFDAAEIRKWVENKKSRRESIVI"
     atggcgaagc agaaaaatcc acgtatgaaa aatacaagcc cataccctga agtcggtaat        60
     gcacgtaaac gccataccgc tgattttctg ggtatatctg attcaacgtt acaccgttgg       120
     gttaaagata aaaagatacc gcagcctttt gagctagagg gtggtttttt tgtctttgat       180
     gcagcagaaa tacgtaaatg ggtagaaaat aaaaaatcac gaagagaatc tatagttata       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page