(data stored in ACNUC1104 zone)

EMBL: FN667742.PE185

FN667742.PE185       Location/Qualifiers
FT   CDS_pept        172629..172847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88278"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88278.1"
FT                   /translation="MTNTTHKNAVISATGEKQLLRVAQMTAFFAELLNNSEGKPISSEG
FT                   MAVVMECLSEQVELIIDESSLMNRDIK"
     atgacaaata ccacacataa aaatgccgtc atttctgcta caggcgaaaa gcagctatta        60
     agagtggcgc agatgacggc attcttcgcc gaattattaa ataacagcga agggaagcct       120
     atttcaagcg aaggtatggc agtcgtcatg gagtgtttat cagaacaagt tgaactcatt       180
     attgatgaaa gcagcctcat gaacagggat attaaataa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page