(data stored in ACNUC1104 zone)

EMBL: FN667742.PE186

FN667742.PE186       Location/Qualifiers
FT   CDS_pept        172847..175561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0191"
FT                   /product="Putative prophage primase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88279"
FT                   /db_xref="GOA:D3VGZ4"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88279.1"
FT                   /translation="MNNQNYPNASTIPTSIPSVTDIVKAANGRWYYILSNLGVSVPENN
FT                   KHGACPKCGGKDRFRFDDKNGKGTWFCNHCGSGDGLDLLKLVTGQDTKTACSEINKILL
FT                   LPEFKKITPTRVKKVGAQKGIELFEKLKTLCFSGESQYLSNKGLTHHNYLITQQQYTQS
FT                   NIIFPIGSLLLPLVDNQRSLKGGQLISPKGEKSLLAGSALSASFIVVVDEADKNIEQVV
FT                   ITEGFATGLSLSKVIDAFIVAAVAATNLVKVAQQLRERWPQAKIIIAGDNDLIDGKENT
FT                   GRSWAEKAAKAVDGWVTLPPTHYKSDWDDYRQENNADKVKEAFFEEMTYCGKDKTYLPQ
FT                   GFRLTQEYLWYDKLVNKSDGDTEVRNIKISSPIKVTAITCDADSSNYGRLLEWEDTYGN
FT                   CRKWAMPMEMLSGSGEELRRVLLVNGLSYINISGQARAHLMEYISLCRPERKVTCVNKT
FT                   GWHGNVYVLQDEVVGAGADSVILQTSSVQGKDFRVSGSSEEWREHIGKYCVGNARLAFS
FT                   VSLAFASSLLKLVGVGGGGYHLKGESTDGKTTTMKVAASVCGGTDYWYTWRATGNALEG
FT                   TACRRNDATLMLDEIREVDGREAGNIAYMLANGQGKARAKTDGSVRETNRWNLLFLSTG
FT                   ELSLVEHASNAGERTYAGVEVRMIQIPSDSGKHGVFEDLHQFASGKSLAEYLEQAVTKY
FT                   HGSPFRDWLKYLTHDLTSISGTAKALLKEYTANMMPENAGNQVGRAITRFALVAMAGEI
FT                   ATRAGITGWQQGEAYAAAEKCLAAWMKERGHTANQEDITALEQVTDFISRNQFSRFADW
FT                   YDENSRPLNMMGFRRVEKGTANQDPTVQFYVLSSAWKEICKGFDSRKVARLCVEKGWLE
FT                   AGKDGRIQTSIRLPEIGLKRVYLFNSDVLGSAE"
     atgaataatc aaaactatcc aaacgcttca acaataccga caagcatacc ttccgtgacg        60
     gatatcgtta aggcagccaa cgggcgttgg tattacattt taagcaattt aggcgtatct       120
     gtacccgaaa ataacaagca tggggcttgc cctaaatgtg gcggcaaaga tcgctttcgg       180
     tttgatgata aaaacgggaa aggcacatgg ttttgtaatc attgtggcag tggtgacgga       240
     ctcgatttac ttaaattagt gacgggtcaa gataccaaaa cggcctgttc tgaaatcaat       300
     aaaatattgc ttttaccgga atttaaaaaa ataacgccaa ccagagtaaa aaaggttggc       360
     gcgcaaaaag gtatcgagtt atttgaaaaa ctgaaaacct tatgtttttc aggggaaagc       420
     caatatctct caaataaagg cttaacccat cataattatt taattactca acaacaatac       480
     acacaaagca acattatttt tccgattggc tcactgttat tgcccttagt tgataaccaa       540
     cgttcactta aaggcggaca attaatcagc ccgaaagggg aaaaaagcct gttagccggt       600
     tctgcgcttt cagcgtcatt tattgttgtc gttgatgaag cggataaaaa cattgaacag       660
     gttgtgatta cagagggttt cgccacaggg ttaagcctgt caaaggtgat tgatgctttc       720
     atcgtggcgg ctgtggcggc cactaactta gtcaaagtcg cgcagcaatt gagagaacgg       780
     tggccacagg caaaaattat tattgccggt gataacgatt tgattgatgg caaagaaaat       840
     acgggcagga gctgggcaga aaaagcggct aaagcagtag atggttgggt cacattaccg       900
     cctactcact ataagtctga ttgggatgac taccgacaag aaaacaatgc agacaaggta       960
     aaagaagcat tctttgagga aatgacctac tgcggaaaag ataaaaccta tttaccgcaa      1020
     ggcttccggc tgactcaaga atatttatgg tatgacaagc tcgtcaataa atcagacggt      1080
     gataccgaag tcaggaacat caaaattagt agcccaataa aagtgactgc aattacctgt      1140
     gatgctgaca gtagtaatta cggacgctta ttagaatggg aggatactta cggtaattgc      1200
     cgtaagtggg ctatgccgat ggaaatgtta agcggaagcg gtgaggagtt acgccgggtg      1260
     cttttggtca atgggctatc ttatatcaac atttcagggc aggcacgagc gcacttgatg      1320
     gagtacattt cgctatgccg tccagagaga aaggtcactt gtgtcaataa aaccggatgg      1380
     cacggtaatg tgtatgtttt gcaagatgaa gttgtcggcg caggtgcgga ctccgttatt      1440
     cttcagactt ccagtgtcca agggaaagac tttagagtct caggctcaag tgaagaatgg      1500
     cgagaacata tcggcaaata ttgcgtagga aacgccagac tcgctttttc cgtaagtttg      1560
     gcctttgcct cttcattgct gaaattagtg ggtgtcggtg gcggaggcta tcacttaaaa      1620
     ggggaatcca ccgatggtaa gacaaccaca atgaaagtgg ctgcgtctgt ctgcggcggc      1680
     acagattact ggtatacatg gcgagccact ggcaatgcgc ttgaagggac agcctgccgc      1740
     cgcaatgatg ctacattgat gctggacgaa atcagagaag ttgacgggcg tgaagcgggt      1800
     aatattgcct atatgctggc aaatggtcag ggtaaggcca gagcgaaaac agacggaagt      1860
     gtcagagaaa ccaaccgctg gaatttattg ttcttatcaa cgggagaact ctctttagtt      1920
     gaacatgcgt caaatgcggg tgaacgcacg tatgccggag tggaagtgcg tatgatccaa      1980
     attccgagtg attcaggtaa acacggtgtg tttgaagact tacaccagtt tgccagcggt      2040
     aaatcactgg ctgagtacct tgaacaggcc gtgactaaat atcatggctc accgttccgc      2100
     gattggctga aatacctcac tcatgatctg acatctatct caggaacggc taaagcctta      2160
     ttgaaagaat ataccgcaaa catgatgcca gagaatgcag gtaatcaggt tggtcgcgca      2220
     attacccgtt ttgcccttgt tgctatggct ggggaaatcg caacacgagc aggaattaca      2280
     ggctggcaac aaggggaagc gtatgcagcg gctgaaaaat gtttagcggc atggatgaaa      2340
     gagcggggac acaccgcgaa tcaggaagat attacggcat tggagcaagt gaccgatttt      2400
     atttcacgta accaattcag ccgctttgcg gattggtacg atgagaatag tcgtcctctc      2460
     aatatgatgg gctttcgtcg cgttgaaaaa ggcactgcaa atcaagatcc aactgttcaa      2520
     ttttatgttt tatcctccgc atggaaagag atatgcaagg gctttgattc gcgcaaagta      2580
     gcccgtttgt gtgttgaaaa gggttggtta gaagcaggca aggacggcag gatacaaacg      2640
     agtatacgcc taccagaaat agggcttaaa cgggtttact tatttaacag tgacgtctta      2700
     ggttctgccg aataa                                                       2715
//

If you have problems or comments...

PBIL Back to PBIL home page