(data stored in ACNUC1104 zone)

EMBL: FN667742.PE188

FN667742.PE188       Location/Qualifiers
FT   CDS_pept        complement(175911..176042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88281"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88281.1"
FT                   /translation="MDLAQTYCDVSSVKNLELKRMYDHIQHHYNNNKFPVCYSILAF"
     gtggatcttg cacaaactta ctgtgacgta tcgagtgtga aaaacttaga gttaaaacgt        60
     atgtatgacc acattcaaca tcattacaac aacaataaat ttccggtatg ttattcaatt       120
     cttgcgtttt ga                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page