(data stored in ACNUC1104 zone)

EMBL: FN667742.PE189

FN667742.PE189       Location/Qualifiers
FT   CDS_pept        176585..176794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0039"
FT                   /locus_tag="XNC1_0194"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88282"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88282.1"
FT                   /translation="MSMLKRPQLTLSLGGLLFYFVNGFRFVINASNAMLTIGGLMITLK
FT                   VSYPQHQSMLPTNLRGAIHGAPAI"
     atgagcatgt taaaaaggcc acagttaacg ctgtctcttg gtgggttatt attttacttt        60
     gtgaatggtt ttagatttgt gataaatgca agcaatgcca tgcttacaat tggtgggcta       120
     atgattacat taaaggtaag ctacccacag catcaatcta tgctaccaac caacctgaga       180
     ggggcgatac atggagcacc agctatttga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page