(data stored in ACNUC1104 zone)

EMBL: FN667742.PE195

FN667742.PE195       Location/Qualifiers
FT   CDS_pept        178523..178663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88288"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88288.1"
FT                   /translation="MTVYSTAVLSLYFRDGQTENKKPTLTVRGSPYSAIGCIICTSRDL
FT                   I"
     atgaccgttt atagtaccgc agtcttatcc ctttatttca gagatggtca gacagaaaat        60
     aaaaaaccga cgttgactgt tcggggaagt ccttatagtg cgattggttg cattatatgt       120
     actagtcgcg acttgatctg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page