(data stored in ACNUC1104 zone)

EMBL: FN667742.PE198

FN667742.PE198       Location/Qualifiers
FT   CDS_pept        180176..180574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0040"
FT                   /locus_tag="XNC1_0203"
FT                   /product="Death on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88291"
FT                   /db_xref="GOA:D3VH06"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88291.1"
FT                   /translation="MIWVSAQEVIAFHDRILQRLPGVAGMPDSGRAEALIYRVQNRTHH
FT                   EGITDIFELAATYWAAIARGHIFNDGNKRTAFFVTMTFLYRNGIKIRDNDNTLENLTVD
FT                   AATGEKTVDQLAQHLRELVDYTNPSCNP"
     atgatatggg tcagcgcaca ggaagttatc gcttttcatg accgaatatt acaacggctt        60
     cccggcgttg ccggaatgcc cgattctggt agagctgaag cgctcatcta tcgggtacaa       120
     aaccgtacac accatgaagg cataacagat atttttgaac ttgcagctac ctattgggct       180
     gctatcgctc gtggtcatat tttcaatgat ggtaataagc gcacagcgtt tttcgttacc       240
     atgacttttc tctatcgtaa cggtatcaag atccgtgata acgacaatac attggaaaac       300
     ttaacagtag atgccgctac gggcgagaaa accgttgacc agttggcgca gcacctgcgc       360
     gaattggtgg actatactaa cccgagctgt aatccatga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page