(data stored in ACNUC1104 zone)

EMBL: FN667742.PE205

FN667742.PE205       Location/Qualifiers
FT   CDS_pept        184389..185051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0210"
FT                   /product="putative membrane protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88298"
FT                   /db_xref="GOA:D3VH13"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88298.1"
FT                   /translation="MVSSNVGESGSRYINDEFISGVTEGSPAVADNGKQRPKAINIVSR
FT                   SLFMPVFILLLVELNIGKTASTIGKEYMTLQQWGFSFKGRIGRREFWIGIGICFALIFT
FT                   LFTLHGMNVLSMNYAAVGVVLLLCPTAAIFSKRLHDRNKRGGWVLLLALAWVLLSLDWE
FT                   LMAPVWQWGVGRFVPTLIFVMIILDCGVFRGTEGANRFGQMAEMVDYISANEPTQKG"
     atggtgtctt caaacgtcgg ggaatcgggc agcagataca tcaacgacga gtttatttct        60
     ggtgtgacag aaggttcacc cgcagtggct gataatggta aacagagacc aaaagcgatt       120
     aatattgtca gcagaagttt attcatgcct gttttcattt tgctactcgt tgagttaaat       180
     attggaaaaa cagcatccac aattggaaaa gaatacatga cattacaaca atggggattc       240
     tcattcaaag gccgaattgg acgacgggag ttttggatcg gcatcggtat ctgtttcgcc       300
     ctgattttta cactttttac attacatgga atgaatgtcc tctccatgaa ttatgcggca       360
     gttggggttg tcctgctgtt gtgtccaact gcggcgattt tttcgaaacg tctgcatgac       420
     cggaataaac ggggtggctg ggtattattg ctcgcattgg cgtgggtatt gctgtccctt       480
     gattgggaat taatggcacc ggtatggcaa tggggagttg gccgttttgt tccaacactg       540
     attttcgtca tgatcatcct tgattgtggt gtcttccggg gcacagaggg cgctaatcgt       600
     tttggtcaga tggcagaaat ggtggattat atttctgcca atgaaccaac tcaaaaaggt       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page