(data stored in ACNUC1104 zone)

EMBL: FN667742.PE227

FN667742.PE227       Location/Qualifiers
FT   CDS_pept        complement(207083..207301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0050"
FT                   /locus_tag="XNC1_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88320"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88320.1"
FT                   /translation="MVHSGKYTNAPIEHSGVTSKFVLDNLSKIPIPALDAYMFGNGGLR
FT                   AGDVIEIVWNRSDLERPIDESLPVLSH"
     atggttcatt caggcaaata taccaatgct ccaatcgaac attctggtgt aacaagtaag        60
     tttgtgctcg ataacctgag taagatacct atccctgctc ttgatgctta tatgtttggc       120
     aatgggggat taagggcggg ggatgtgatt gaaatagtat ggaaccgctc tgatctggaa       180
     aggccgatag acgaaagcct accggttctg tcgcattaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page