(data stored in ACNUC1104 zone)

EMBL: FN667742.PE228

FN667742.PE228       Location/Qualifiers
FT   CDS_pept        complement(207395..208783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0233"
FT                   /product="Sea14 (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88321"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88321.1"
FT                   /translation="MKIVMTAMVIHDDGSTTQETLLTLQKTAEQDEPLGLSLNESKKLL
FT                   NHAQLSIIQSQTQAYMQTHRECPHCHQRRQIKDHQTRHYHTLFGVIPIKGLRLYRCNCE
FT                   RNNTKSVSLLSEWLPENIHPELKYIEAKWASLMSYNLTVDRLKDILPINKALNASTVRN
FT                   HLISVARRQEAELAEKPDFLNKTADDNDNLPRPGKPMVIGFDGGYIRDCHNRKNNFEII
FT                   TGKAYAENIQAKRFGYVHMFENNPRKRLLSVLGAQGMQTNQQISFLSDGADNLRMMQIG
FT                   IYPEAEHILDWFHISMRLTVLNQCAKGLITQSTDIGSILQNLLEKTKWYLWHGNVDEAL
FT                   DQLDSCLYTCDNEEDNPVYKHSKKMVRYLDEMMTYIGNNQAMIPNYGERHRYGEPISTA
FT                   FVESTVNEVIAKRMAKKQQMQWSQEGAHYLLQTRVAVLNDELESLFHCWYPKLASSGLN
FT                   AMAA"
     atgaaaatcg taatgacagc aatggttata cacgatgatg gctccaccac tcaagaaacc        60
     ttattgacat tacagaaaac cgccgaacaa gatgaacctt tgggattatc tctcaacgaa       120
     tcaaaaaaat tactcaatca cgcacaattg tcaatcatac aatctcaaac ccaagcttac       180
     atgcaaacgc atcgagaatg cccacactgt catcaacgtc gtcaaataaa agatcatcaa       240
     acacgtcatt atcatacttt atttggggtc attcctatta aagggcttcg gctttatcgc       300
     tgtaactgtg agagaaataa taccaaatca gtcagcttac tcagtgagtg gctacccgaa       360
     aatatccatc ccgaactaaa atatattgaa gccaaatggg cctccttgat gtcttacaat       420
     cttactgtgg atagattgaa agatatttta ccaatcaata aagcgttaaa tgcctccacg       480
     gtgcgtaatc acttaatcag tgtcgctaga cggcaagaag ctgagttagc cgagaagcca       540
     gattttctca ataaaacggc tgatgacaat gataatttgc cccgcccagg aaaaccgatg       600
     gtgataggat ttgacggtgg ctatatcagg gattgccata accggaaaaa caattttgaa       660
     atcattacag gaaaagcgta tgccgaaaat attcaagcga aacggtttgg ttatgttcac       720
     atgtttgaaa ataacccaag gaaacgcttg ctttctgtac tcggtgccca agggatgcaa       780
     actaaccagc agatatcttt tttatcagat ggggctgata atctgaggat gatgcaaatc       840
     ggtatttacc cagaagctga gcatatctta gattggtttc atattagtat gcgcctaacc       900
     gtgcttaatc agtgcgctaa aggtctcatc acacaatcaa ctgatattgg ttcaatactg       960
     caaaatttac tcgaaaaaac aaaatggtac ttatggcatg gtaatgtcga tgaggcatta      1020
     gatcagctcg atagctgttt atatacttgt gacaatgaag aagataaccc agtctataaa      1080
     cacagtaaaa aaatggtgcg gtatttagat gaaatgatga cttacattgg taataaccaa      1140
     gcgatgatcc ccaattatgg agaacggcat cgttatggcg agccaatctc aacggcattt      1200
     gtggaatcaa ccgtgaatga agttatcgca aaacggatgg cgaaaaaaca gcaaatgcaa      1260
     tggagccaag aaggagcaca ttatctttta caaactcgag tggccgtttt aaatgatgaa      1320
     ttagaaagtc tctttcactg ctggtatcct aaattggcaa gctcagggct gaatgcaatg      1380
     gcagcataa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page